Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate GFF1638 PGA1_c16600 methionine gamma-lyase MdeA
Query= SwissProt::P55218 (403 letters) >FitnessBrowser__Phaeo:GFF1638 Length = 401 Score = 320 bits (819), Expect = 6e-92 Identities = 162/390 (41%), Positives = 245/390 (62%), Gaps = 3/390 (0%) Query: 16 GAAFDTLAVRAG-QRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGNVYSRYTNPT 74 G++F T A+ G ++ +G L+ TS++ F +A F GE G+ YSR +NPT Sbjct: 5 GSSFSTRAIHHGYDTQSQQGSLNPPLYLTSTFTFDSAEAGGEMFTGEREGHFYSRISNPT 64 Query: 75 VRTFEERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFK 134 + E+RIA LEG E +ATASGM AI + + S ++GD +++ ++++G T S Sbjct: 65 LDHLEQRIANLEGGEAGLATASGMGAITSTLWSFLAAGDEIILDKTLYGCTFSFMTHGLP 124 Query: 135 RFGIQVDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLAVD 194 RFG++V ++D A P TKL + E+P+NP L+DIAA++EIAH GA + VD Sbjct: 125 RFGVKVRLVDMTDPTNLAEAISPKTKLVYFETPANPNNRLIDIAAISEIAHKAGAKVVVD 184 Query: 195 NCFCTPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEV--VGFLRTAGPT 252 N F TP L +P++LGAD+V+HSATK+I G G + G+V G E++ ++ VG G Sbjct: 185 NTFATPVLTRPIELGADIVVHSATKFISGHGDVIAGLVVGSKEEITQIRLVGLKDMTGAV 244 Query: 253 LSPFNAWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQ 312 +SPF+A L ++GL+TL +RM+ H SAL +AE L+ P +ERVYY GL Q +LARRQ Sbjct: 245 MSPFSAMLLMRGLKTLELRMERHCKSALKVAEALQAHPAVERVYYPGLDDFAQGDLARRQ 304 Query: 313 QSGFGAVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRAR 372 SGFG ++ F+V GG+ ++ M+ +LGD +T I HPA+ +H +PE+RA Sbjct: 305 MSGFGGMIPFEVVGGKAGGIAMMNRLAMIQRAVSLGDAETLIQHPASMTHSTYTPEERAE 364 Query: 373 AGIGDSLIRVAVGLEDLDDLKADMARGLAA 402 GI + L+R++VGLE +DD+ D+ + L++ Sbjct: 365 HGIAEGLVRMSVGLEGVDDIIDDLMQALSS 394 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 401 Length adjustment: 31 Effective length of query: 372 Effective length of database: 370 Effective search space: 137640 Effective search space used: 137640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory