Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate GFF1988 PGA1_c20220 acetolactate synthase isozyme 3 small subunit
Query= BRENDA::P00894 (163 letters) >FitnessBrowser__Phaeo:GFF1988 Length = 186 Score = 127 bits (320), Expect = 8e-35 Identities = 73/160 (45%), Positives = 104/160 (65%), Gaps = 3/160 (1%) Query: 2 RRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDP-TLSRMTIQTVGDEKVLEQI 60 R +++L+ENE G L+RVIGLFS RGYNI+SLTVA D LSR+TI T G +V+EQI Sbjct: 28 RHTITILVENEPGVLARVIGLFSGRGYNIDSLTVAEVDHTGHLSRITIVTTGTPQVIEQI 87 Query: 61 EKQLHKLVDVLRVSELG-QGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSL 119 + QL ++V V V++L G VERE+ +VK+ G R E R EIFR +++D T + Sbjct: 88 KAQLGRIVSVHEVTDLTVAGPFVERELAIVKVVGEGEKRVEAMRLAEIFRAKVVDTTLNS 147 Query: 120 YTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGD 159 + +L G K+DAF +R + + ++AR+GV L RG+ Sbjct: 148 FIFELTGAPDKIDAFAEMMRPLG-LTKIARTGVAALLRGN 186 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 89 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 186 Length adjustment: 19 Effective length of query: 144 Effective length of database: 167 Effective search space: 24048 Effective search space used: 24048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
Align candidate GFF1988 PGA1_c20220 (acetolactate synthase isozyme 3 small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.3107.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.3107.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.