Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate SMc01340 SMc01340 aminotransferase
Query= BRENDA::Q56232 (385 letters) >FitnessBrowser__Smeli:SMc01340 Length = 385 Score = 190 bits (483), Expect = 5e-53 Identities = 130/390 (33%), Positives = 191/390 (48%), Gaps = 14/390 (3%) Query: 1 MRGLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQG 60 M +S+R A++P + V A+A R G ++++ G+P P+ +AARRAL G Sbjct: 1 MAQMSKR-SAVEPFHAMDVLAEATRRRDSGHPVISMAVGQPAHPAPKAALDAARRALDHG 59 Query: 61 KTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIV 120 + Y G L+ A+A + +G+++ P+ VT G F A+ DPGD V + Sbjct: 60 RLGYTDALGTHSLKRAIAAHYHSRHGITLDPQRIAVTTGSSAGFNLAFLALFDPGDRVAI 119 Query: 121 LSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKAL---VVNSPNNPT 177 P + +Y ++ G VVE+E E GF P+ + A K L ++ SP NPT Sbjct: 120 ARPGYPAYRNIMAALGLEVVEIEANAEAGFTLTPDSLEGAAARAGKPLKGVLLASPANPT 179 Query: 178 GAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFA 237 G V K L+ALA +H +SDEIY L + GE + VA + + +N +K + Sbjct: 180 GTVTGKAQLKALADYCRDHSIAFISDEIYHGLTFAGEETTALEVA-DDAVVINSFSKYYC 238 Query: 238 MTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYR 297 MTGWRIG+ P+ ++A ++ SP ++Q A AL E + + AY Sbjct: 239 MTGWRIGWMVLPEARVRAFERIAQSLYISPPELSQIAAEAALGAHEELDGY----KRAYA 294 Query: 298 RRRDLLLEGLTALGLKAVRP-SGAFYVLMDTSPIAPDEVRAAERLL-EAGVAVVPGTDFA 355 R LLLE L +G P GAFY D S D + A R+L E VA PG DF Sbjct: 295 ANRALLLERLPQIGFSIASPMDGAFYAYADVSRFTNDSMAFARRMLAEIDVAATPGFDFD 354 Query: 356 AF-GH--VRLSYATSEENLRKALERFARVL 382 GH +R SYA + + +A+ R AR L Sbjct: 355 PLEGHRTMRFSYAGAATEMEEAMNRIARWL 384 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 385 Length adjustment: 30 Effective length of query: 355 Effective length of database: 355 Effective search space: 126025 Effective search space used: 126025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory