Align glutamyl-tRNAGln amidotransferase subunit C (EC 6.3.5.7) (characterized)
to candidate Synpcc7942_2322 Synpcc7942_2322 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
Query= metacyc::MONOMER-13957 (96 letters) >FitnessBrowser__SynE:Synpcc7942_2322 Length = 96 Score = 85.9 bits (211), Expect = 1e-22 Identities = 41/92 (44%), Positives = 64/92 (69%) Query: 4 ISIEEVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMKNVM 63 I++E+V VAHLARLA+T EE + FT QL+SI+ + E+L+E+ T++V+PTT +++ NV Sbjct: 3 ITLEQVHKVAHLARLALTPEEEQQFTTQLNSILEYVEQLSELPTEDVQPTTRAIEVVNVT 62 Query: 64 REDEAGKGLPVEDVMKNAPDHKDGYIRVPSIL 95 R D+ E+++ APD + + RVP IL Sbjct: 63 RPDDVKPAENREELLSIAPDQEGDFFRVPQIL 94 Lambda K H 0.312 0.130 0.349 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 45 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 96 Length of database: 96 Length adjustment: 10 Effective length of query: 86 Effective length of database: 86 Effective search space: 7396 Effective search space used: 7396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.5 bits) S2: 39 (19.6 bits)
Align candidate Synpcc7942_2322 Synpcc7942_2322 (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))
../bin/blast/fastacmd -i /tmp/list.32343.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.32343.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.