Align 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate GFF3703 PS417_18950 3-dehydroquinate dehydratase
Query= BRENDA::P15474 (157 letters) >FitnessBrowser__WCS417:GFF3703 Length = 148 Score = 153 bits (386), Expect = 1e-42 Identities = 79/141 (56%), Positives = 96/141 (68%), Gaps = 1/141 (0%) Query: 9 PIMILNGPNLNLLGQRQPEIYGSDTLADVEALCVKAAAAHGGTVDFRQSNHEGELVDWIH 68 P+ LNGPN NL G + YGS++ A ++A C AA G T+DFRQSNHEG LVDWI Sbjct: 4 PVFFLNGPNANLYGLDKAGTYGSESFASIQARCQDLAATLGLTLDFRQSNHEGVLVDWIQ 63 Query: 69 EARLNHCGIVINPAAYSHTSVAILDALNTCDGLPVVEVHISNIHQREPFRHHSYVSQRAD 128 EARLN IVIN A S++SV ILDAL DG P++E H+SNI +RE FRHHSYVS+ A Sbjct: 64 EARLNADAIVINAAGLSYSSVPILDALLAFDG-PIIETHMSNIWKRERFRHHSYVSKAAT 122 Query: 129 GVVAGCGVQGYVFGVERIAAL 149 GV+AG G GY + +A L Sbjct: 123 GVIAGLGALGYQLALTAVAEL 143 Lambda K H 0.320 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 80 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 157 Length of database: 148 Length adjustment: 17 Effective length of query: 140 Effective length of database: 131 Effective search space: 18340 Effective search space used: 18340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory