Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate AZOBR_RS10940 AZOBR_RS10940 3-phosphoglycerate dehydrogenase
Query= BRENDA::Q9I6H5 (409 letters) >FitnessBrowser__azobra:AZOBR_RS10940 Length = 415 Score = 482 bits (1241), Expect = e-141 Identities = 243/411 (59%), Positives = 310/411 (75%), Gaps = 2/411 (0%) Query: 1 MSKTSLDKSKIKFLLLEGVHQNAVDTLKAAGYTNIEYLKTALSGDELKERIADAHFIGIR 60 ++K SL K KI LLLEGVH NA++ L GY +E L AL EL ERI H +GIR Sbjct: 1 VTKLSLSKDKINILLLEGVHDNAINELAHGGYATVERLPHALDESELLERIGSVHMLGIR 60 Query: 61 SRTQLTEEVFDCAKKLIAVGCFCIGTNQVDLNAARERGIAVFNAPYSNTRSVAELVLAEA 120 SRT LT +V + A +L +VGCFCIGTNQVDL AAR GI VFNAPYSNTRSVAELV+ E Sbjct: 61 SRTHLTAKVLEAASRLFSVGCFCIGTNQVDLKAARRLGIPVFNAPYSNTRSVAELVIGEI 120 Query: 121 ILLLRGIPEKNASCHRGGWIKSAANSFEIRGKKLGIVGYGSIGTQLSVLAEALGMQVFFY 180 I+L+RGI K+ H GGW+KSA +S+EIRGK LGIVGYG IGTQ+S++AE++GM+V +Y Sbjct: 121 IMLMRGIFSKSNLVHGGGWMKSAKDSYEIRGKTLGIVGYGHIGTQVSIMAESMGMKVRYY 180 Query: 181 DTVTKLPLGNAVQIGSLHELLGMSDIVSLHVPELPSTQWMIGEKEIRAMKKGGILINAAR 240 D V KL LGNA SL ELL +SD+V+LHVP+ P T+ MIGE +IRAMKKG LINAAR Sbjct: 181 DVVNKLALGNAQPCHSLEELLAVSDVVTLHVPDTPQTRDMIGEAQIRAMKKGAHLINAAR 240 Query: 241 GTVVELDHLAAAIKDEHLIGAAIDVFPVEPKSNDEEFASPLRGLDRVILTPHIGGSTAEA 300 G VV ++ LAAA++D+HL+GAAIDVFP EP + E F S LRGLD ILTPHIGGST EA Sbjct: 241 GKVVVIEALAAALRDKHLLGAAIDVFPKEPGGDKEVFESALRGLDNAILTPHIGGSTMEA 300 Query: 301 QANIGLEVAEKLVKYSDNGTSVSSVNFPEVALP-SHPGKHRLLHIHANIPGVMSEINKVF 359 QANIG EV++KL++YSDNG+++ +VNFP+V LP H G R LH+H N PGV+ +IN+VF Sbjct: 301 QANIGTEVSQKLIEYSDNGSTMGAVNFPQVGLPVVHAGSTRFLHVHENRPGVLRKINEVF 360 Query: 360 ADNGINVSGQYLQTNEKVGYVVIDVDAEYSDLAL-EKLQQVNGTIRSRVLF 409 + +N++ QYLQT+ ++GYVV+DVD + + + L+ + GT+++R L+ Sbjct: 361 SGRNLNIAAQYLQTDPELGYVVVDVDGDVDENEVASDLRAIEGTLKARFLY 411 Lambda K H 0.317 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 409 Length of database: 415 Length adjustment: 31 Effective length of query: 378 Effective length of database: 384 Effective search space: 145152 Effective search space used: 145152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory