Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25); quinate/shikimate dehydrogenase [NAD(P)+] (EC 1.1.1.282) (characterized)
to candidate AO356_01830 AO356_01830 shikimate dehydrogenase
Query= BRENDA::Q88GF6 (273 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_01830 Length = 273 Score = 386 bits (992), Expect = e-112 Identities = 192/272 (70%), Positives = 223/272 (81%) Query: 1 MPTTPSRDTVLCISLAGRPGTFGVRFHNHLYQQLGLDFYYKAMRTDDLPAAVAGIRALGI 60 M P++DT LC+SL+GRPG FG+RFHNHLY+QLGL+FYYKA + DLP AV GIRALGI Sbjct: 1 MQINPNKDTQLCMSLSGRPGNFGLRFHNHLYEQLGLNFYYKAFSSQDLPGAVGGIRALGI 60 Query: 61 RGCGVSMPYKEACMALVDEIDPSAAAIESVNTLVNCNGHLKAYNTDYLAVRQLLAQHQVD 120 RGCGVSMP+KEAC+ALVDE+DPSAAAI+S+NT+VN NGHLKAYNTDY+A+ QLL H V Sbjct: 61 RGCGVSMPFKEACIALVDELDPSAAAIQSINTIVNTNGHLKAYNTDYIAIAQLLQSHAVP 120 Query: 121 PGTAFALRGSGGMAKAVASALRDAGFAEGIIVARNEQAGRQLADVCGYRWVPEPGDICPP 180 + FALRGSGGMAKAVASALRD G+ G+IVARNE GR LA+ GY W E G P Sbjct: 121 QDSTFALRGSGGMAKAVASALRDGGYRNGLIVARNEATGRALAESLGYEWQAELGARRPQ 180 Query: 181 MLVNVTPIGMAGGLEAEELAFPEHAIAAAERVFDVVAMPAQTPLIRRAQALGKPVITGLE 240 ML+NVTPIGM GG EA++LAF IAAAE VFDVVA+P++TPLI RA+A GK VITGLE Sbjct: 181 MLINVTPIGMTGGPEADQLAFEPETIAAAETVFDVVAIPSETPLIVRARAEGKRVITGLE 240 Query: 241 VIALQALEQFVLYTGVRPTREQVDAAVAYARA 272 VIA+QALEQFVLYTGVRP EQ + AVA+AR+ Sbjct: 241 VIAIQALEQFVLYTGVRPNLEQFEKAVAFARS 272 Lambda K H 0.322 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 273 Length adjustment: 25 Effective length of query: 248 Effective length of database: 248 Effective search space: 61504 Effective search space used: 61504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory