Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (characterized)
to candidate AO356_05050 AO356_05050 glutamate-pyruvate aminotransferase
Query= SwissProt::Q2RK33 (390 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_05050 Length = 405 Score = 345 bits (886), Expect = 1e-99 Identities = 161/380 (42%), Positives = 245/380 (64%), Gaps = 3/380 (0%) Query: 6 RIRELPPYLFARIEKKIAEARERGVDIISLGIGDPDMPTPSHVIDKLVAEAHNPENHRYP 65 RI LPPY+F + AR RG DII L +G+PD TP H+++KLV A + H Y Sbjct: 12 RIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGATPPHIVEKLVTVAQREDTHGYS 71 Query: 66 TSEGLLAFRQAVADWYQRLYGVDLDPRREVVTLIGSKEGIAHISLCYVDPGDINLVPDPG 125 TS+G+ R+A++ WY+ Y VD+DP E + IGSKEG+AH+ L +D GD LVP+P Sbjct: 72 TSKGIPRLRRAISRWYKDRYEVDIDPETEAIVTIGSKEGLAHLMLATLDQGDTVLVPNPS 131 Query: 126 YPVYNIGTLLAGGESYFMPLTAANGFLPDLGAIPSDVARRAKLMFINYPNNPTGAVADLK 185 YP++ G ++AG + +PL F +L + K+M + +P+NPT +L Sbjct: 132 YPIHIYGAVIAGAQVRSVPLVPGVDFFDELERAIRGSIPKPKMMILGFPSNPTAQCVELD 191 Query: 186 FFQEVVEFARSYDLIVCHDAAYSEITYDGYRAPSFLQAPGAKEVGIEFNSVSKPYNMTGW 245 FF+ V+ A+ YD++V HD AY++I YDG++APS +Q PGAK++ +EF ++SK YNM GW Sbjct: 192 FFERVIALAKQYDVLVIHDLAYADIVYDGWKAPSIMQVPGAKDIAVEFFTLSKSYNMAGW 251 Query: 246 RLGWACGRADVIEALARIKSNIDSGAFQAVQYAGIAALTGPQEGLAEVRRVYQERRDIIV 305 R+G+ G +++ ALARIKS D G F +Q A IAAL G Q+ + ++ Y++RR+++V Sbjct: 252 RIGFMVGNPELVNALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIAEQYRQRRNVLV 311 Query: 306 EGFNSLGWHLEKPKATFYVWAPVPRGYT---SASFAEMVLEKAGVIITPGNGYGNYGEGY 362 +G + LGW +E PKA+ YVWA +P Y S FA+ +L +A V ++PG G+G YG+ + Sbjct: 312 KGLHELGWMVENPKASMYVWAKIPEAYAHLGSLEFAKKLLAEAKVCVSPGVGFGEYGDDH 371 Query: 363 FRIALTISKERMQEAIERLR 382 R AL +++R+++A+ +R Sbjct: 372 VRFALIENQDRIRQAVRGIR 391 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 493 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 405 Length adjustment: 31 Effective length of query: 359 Effective length of database: 374 Effective search space: 134266 Effective search space used: 134266 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory