Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate AO356_21425 AO356_21425 aspartate-semialdehyde dehydrogenase
Query= SwissProt::P23247 (337 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_21425 Length = 336 Score = 274 bits (700), Expect = 3e-78 Identities = 139/335 (41%), Positives = 213/335 (63%), Gaps = 1/335 (0%) Query: 1 MSQQFNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVE 60 MSQ F++A+ GATG VGET++++L+ER+FPV L LLAS S G + F GK VRV+ V+ Sbjct: 1 MSQSFDIAVIGATGTVGETLVQILEERDFPVGNLHLLASSESAGSSVMFRGKNVRVREVD 60 Query: 61 EFDWSQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAE 120 EFD+S+V + F+AG ++ +AP A AG +ID + + P +VPE N + +A Sbjct: 61 EFDFSKVQLVFFAAGPAVTLSFAPRATAAGCALIDLSGALPPE-QAPQIVPEANAQVLAG 119 Query: 121 FRNRNIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLL 180 +++P+ S + V L P+ + + ++RI++T +VS G+ + ELA QTA+LL Sbjct: 120 LGKPLQVSSPSASATALAVVLAPLRECLDLQRISLTASLAVSAQGRVAVSELARQTAELL 179 Query: 181 NGYPAETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVP 240 N P E F +Q+AFN + Q+ + G+T E ++V E +++ N P + ++ TC++ P Sbjct: 180 NARPLEPKFFDRQMAFNLLAQVGAPDEQGHTSLEKRLVRELRQVLNQPLLKISVTCIQAP 239 Query: 241 VFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIELFRGADFPTQVRDAGGKDHVLVGRVRN 300 VF+G + +V V++ +D +V LE GIEL D+PT V DA G+D V VGRVR Sbjct: 240 VFFGDSFSVTVQSANAVDLAKVNAALEAAPGIELVEAGDYPTAVGDAVGQDVVYVGRVRG 299 Query: 301 DISHHSGINLWVVADNVRKGAATNAVQIAELLVRD 335 I + +N+W+ +DNVRKGAA NAVQ+AELL++D Sbjct: 300 GIDDPTELNMWLTSDNVRKGAALNAVQVAELLIKD 334 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 336 Length adjustment: 28 Effective length of query: 309 Effective length of database: 308 Effective search space: 95172 Effective search space used: 95172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory