Align Homoserine dehydrogenase; HDH; EC 1.1.1.3 (uncharacterized)
to candidate AO356_15140 AO356_15140 homoserine dehydrogenase
Query= curated2:Q58997 (336 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_15140 Length = 352 Score = 216 bits (549), Expect = 9e-61 Identities = 135/342 (39%), Positives = 195/342 (57%), Gaps = 9/342 (2%) Query: 3 IIIVGFGAIGKGIAKVLYDKKDYLKKNYE-EFKVVAITDSS-GAAIDEDGLDLLKAIEVK 60 + +VGFG + + +A+++ ++ + K + K+V +TD G+ +D GLD + Sbjct: 6 LALVGFGGVNRALAQLIAERNESWKTDLGFTLKIVGVTDLFLGSVMDRHGLDAASLARLP 65 Query: 61 EKTGKIKNYPEKGREMSSIDVIKEVDADVVVEVTPSNLETGDPAKTHILESFKNKKHVVT 120 G + P + + VIK+ AD++ E T +N G+PA + + + KHVVT Sbjct: 66 ATQGAMAQLPGGTVDALNEAVIKDCGADIIAEATFTNPVDGEPATSFCRWALERGKHVVT 125 Query: 121 ANKGPLALCYKELIEEAKKHGVIFRHEASVGGAMPIINLAKETLAGNEILSIRGILNGTT 180 NKGP+AL EL A+++ V F +E SV P+I LAK++LAG+ I GILNGT+ Sbjct: 126 TNKGPIALHGAELKALAQRNNVAFEYEGSVMSGTPVIRLAKQSLAGSSISGFEGILNGTS 185 Query: 181 NYILTKMEKEGLDFETALKEAKELGIAETDPTQDIEGLDTAAKIVILANSIMGMNKTIKD 240 N++LT ME GL F A+K+A+ELG AE DPT D+EG D KIVILAN ++ T+ D Sbjct: 186 NFVLTCME-GGLGFAEAVKKAQELGYAEADPTADVEGHDVRLKIVILANELLDAKLTVND 244 Query: 241 VKVKGISRITPEALFLANKRGYTIKLIG---QIKDGYL--IVEPMLVPIDSPL-NVKGTL 294 V GIS ++ + A G KLIG + DG + VEP L+ D PL +V G Sbjct: 245 VTCSGISALSLADIEKARHDGARWKLIGAATRQADGSISASVEPRLLSNDHPLASVSGAT 304 Query: 295 NVAMFETDLAKEVVVVGRGAGPIETASAILSDLIHIYNSTKK 336 N F ++L V V G GAG ETA A+LSD+IHI+ S + Sbjct: 305 NAVSFTSELLGAVTVSGPGAGRTETAFALLSDIIHIHQSATR 346 Lambda K H 0.314 0.135 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 352 Length adjustment: 29 Effective length of query: 307 Effective length of database: 323 Effective search space: 99161 Effective search space used: 99161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory