Align Ornithine aminotransferase; OAT; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase (uncharacterized)
to candidate AO356_17010 AO356_17010 acetylornithine aminotransferase
Query= curated2:Q89RB7 (404 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_17010 Length = 391 Score = 265 bits (678), Expect = 1e-75 Identities = 157/388 (40%), Positives = 218/388 (56%), Gaps = 13/388 (3%) Query: 20 YEPIGVVLSRGEGVWVWDTDGNRYLDCLSAYSAVSQGHCHPKILAAMVEQAHRLTLTSRA 79 Y+P+ + + G G +WD DG YLD ++ + + GH HP+++AA+ EQA L TS Sbjct: 10 YQPLALNFTHGLGTRLWDQDGREYLDAVAGVAVTNVGHSHPRLVAAISEQAGLLLHTSNL 69 Query: 80 FHNDQLAPFYEEIAALTGSHKVLPMNSGAEAVESAIKSVRKWGYEVKGVPDDQAEIIVCA 139 + D +++ L+G + NSGAEA E+A+K R +G+ KG+ +Q ++V Sbjct: 70 YSIDWQQRLAQKLTQLSGMERAFFNNSGAEANETALKLARLYGWH-KGI--EQPLVVVMD 126 Query: 140 DNFHGRTLGIVGFSTDPETRGHFGPFAPGFRIIPFGDAAALEQ---AITPNTVAFLVEPI 196 + FHGRTLG + S P R + F +PFGD AALEQ A VA LVEPI Sbjct: 127 NAFHGRTLGTMSASDGPSVRLGYNRLPGDFIKVPFGDLAALEQIQQAHAERIVAVLVEPI 186 Query: 197 QGEAGVIIPPAGYFTKVRELCTANNVMLVLDEIQTGLGRTGKLLAEQHEGIEADVTLLGK 256 QGE+GV + P GY +R+LC+ +L+LDEIQTG+GRTG+ A QHEGI DV L K Sbjct: 187 QGESGVQLAPPGYLKALRQLCSRRAWLLMLDEIQTGIGRTGQWFAFQHEGIVPDVMTLAK 246 Query: 257 ALAGGFYPVSAVLSNNEVLGTLRPGQHGSTFGGNPLACAVARAAMRVLVEEGMIENAARQ 316 L G P+ A L+ + PG HGSTFGGNPLAC V + ++ E+ ++ NA Q Sbjct: 247 GLGNG-VPIGACLARGKAAELFTPGSHGSTFGGNPLACRVGCTVLDIIEEQALVGNARHQ 305 Query: 317 GARLLEGLKDIRAN--TVREVRGRGLMLAVEL-HPEAGRARRYCEALQGKGILAKDTHGH 373 G +LL L+ A V +RG+GLM+ +EL P R A + G+L T G Sbjct: 306 GEQLLSRLRTELAENPNVLAIRGQGLMIGIELKQPVRDLTLR---AARDHGLLINVTRGQ 362 Query: 374 TIRIAPPLVITSDEVDWALEQFATTLTQ 401 TIR+ PPL I EV+ + + L Q Sbjct: 363 TIRLLPPLTIDGREVEMIVRGVSRCLAQ 390 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 391 Length adjustment: 31 Effective length of query: 373 Effective length of database: 360 Effective search space: 134280 Effective search space used: 134280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory