Align Arginine biosynthesis bifunctional protein ArgJ; EC 2.3.1.35; EC 2.3.1.1 (characterized)
to candidate AO356_12410 AO356_12410 ornithine acetyltransferase
Query= SwissProt::Q07908 (410 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_12410 Length = 385 Score = 275 bits (703), Expect = 2e-78 Identities = 167/401 (41%), Positives = 232/401 (57%), Gaps = 26/401 (6%) Query: 17 TVVTPEGFQAAGVNAGLRYSKNDLGVILCDVPASAAAVYTQSHFQAAPLKVTQASLAVEQ 76 T + P+GF++ N G++ S++D ++ DVPAS +AV+TQS F A P +A Sbjct: 4 THIQPKGFRSIIANLGIKDSRDDFMAVISDVPASISAVFTQSRF-AGPSVTLSREVAQRD 62 Query: 77 KLQAVIVNRPCANACTGAQGLKDAYEMRELCAKQFGLALHHVAVASTGVIGEYLPMEKIR 136 Q V+V AN TG +GL +A E+R A+ + + +ASTGVIG PMEKIR Sbjct: 63 TAQGVVVIARNANVATGPEGLANAQEVRAGLARAVDVDPQALVIASTGVIGRQYPMEKIR 122 Query: 137 AGIKQLVPGVTMADAEAFQTAILTTDTVMKRACYQTTIDGKTVTVGGAAKGSGMIHPNMA 196 + VP + AD + AI+TTDT K A Q + ++ G AKG GMI PNMA Sbjct: 123 TFLGN-VPPLQPADFQRCAAAIMTTDTHTKYAARQVG----SASLVGIAKGVGMIEPNMA 177 Query: 197 TMLAFITTDANVSSPVLHAALRSITDVSFNQITVDGDTSTNDMVVVMASGLAGNDELTPD 256 T+L F TDA ++ VL A R + D +FN +++D DTST+D ++A+GLAG ++ Sbjct: 178 TLLTFFFTDARIAPDVLDALFRRVIDKTFNALSIDTDTSTSDSAAILANGLAGEVDMV-- 235 Query: 257 HPDWENFYEALRKTCEDLAKQIAKDGEGATKLIEVRVRGAKTDEEAKKIAKQIVGSNLVK 316 F +AL L + IA DGEGA+K +EV V GA+ D +AK++AK IV S LVK Sbjct: 236 -----EFEQALYDIALGLVRMIASDGEGASKALEVHVTGARDDAQAKRVAKAIVNSPLVK 290 Query: 317 TAVYGADANWGRIIGAIGYSDAE--VNPDNVDVAIGPMVMLKGSEPQPFSEEEAA----- 369 TAV+GAD NWGR+ AIG +AE ++PD V + G +E P +EA Sbjct: 291 TAVHGADPNWGRVAMAIGKCEAEQDIDPDKVRIVFGE------TEAYPQQLDEAGLLAVK 344 Query: 370 AYLQQETVVIEVDLHIGDGVGVAWGCDLTYDYVKINASYRT 410 YLQ + V+I VDL+I G +GCDL+ Y++INA Y T Sbjct: 345 GYLQGKEVLISVDLNIAQGQFTVYGCDLSEGYIRINADYTT 385 Lambda K H 0.316 0.130 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 385 Length adjustment: 31 Effective length of query: 379 Effective length of database: 354 Effective search space: 134166 Effective search space used: 134166 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory