GapMind for Amino acid biosynthesis

 

Alignments for a candidate for gatC in Trichodesmium erythraeum IMS101 Annotated Metagenome-Assembled Genome

Align glutamyl-tRNAGln amidotransferase subunit C (EC 6.3.5.7) (characterized)
to candidate 2629601552 Ga0074568_113619 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

Query= metacyc::MONOMER-13957
         (96 letters)



>IMG__TrieryIMS101_FD:2629601552
          Length = 97

 Score = 76.6 bits (187), Expect = 6e-20
 Identities = 38/92 (41%), Positives = 58/92 (63%)

Query: 4  ISIEEVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMKNVM 63
          I  E+V+ VAHLARL +  EE +MFT QL SI+ + E+L+E++T+ V PTT  + + NV 
Sbjct: 3  IDNEQVRKVAHLARLELDSEEEEMFTTQLSSILEYFEQLSELDTEIVPPTTRAIDVNNVT 62

Query: 64 REDEAGKGLPVEDVMKNAPDHKDGYIRVPSIL 95
          R+D        ED++  AP+    + +VP I+
Sbjct: 63 RKDSLEPFPYREDILSCAPEQNGDFFKVPKIM 94


Lambda     K      H
   0.312    0.130    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 48
Number of extensions: 3
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 96
Length of database: 97
Length adjustment: 10
Effective length of query: 86
Effective length of database: 87
Effective search space:     7482
Effective search space used:     7482
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.5 bits)
S2: 39 (19.6 bits)

Align candidate 2629601552 Ga0074568_113619 (aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00135.hmm
# target sequence database:        /tmp/gapView.3606112.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00135  [M=93]
Accession:   TIGR00135
Description: gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                        -----------
    1.8e-31   94.6   0.2      2e-31   94.4   0.2    1.0  1  IMG__TrieryIMS101_FD:2629601552  


Domain annotation for each sequence (and alignments):
>> IMG__TrieryIMS101_FD:2629601552  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   94.4   0.2     2e-31     2e-31       1      92 [.       3      94 ..       3      95 .. 0.99

  Alignments for each domain:
  == domain 1  score: 94.4 bits;  conditional E-value: 2e-31
                        TIGR00135  1 iskeevkrlakLarlelseeeaekfaeeLkeilklveqlsevdtenvepmanplelsnklReDeveeslkrkeilknape 80
                                     i++e+v+++a+Larlel+ ee+e+f+++L++il+++eqlse+dte v p+++ ++  n++R+D  e    r++il++ape
  IMG__TrieryIMS101_FD:2629601552  3 IDNEQVRKVAHLARLELDSEEEEMFTTQLSSILEYFEQLSELDTEIVPPTTRAIDVNNVTRKDSLEPFPYREDILSCAPE 82
                                     799***************************************************************************** PP

                        TIGR00135 81 kedgfikvPkil 92
                                     ++ +f+kvPki+
  IMG__TrieryIMS101_FD:2629601552 83 QNGDFFKVPKIM 94
                                     **********97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (93 nodes)
Target sequences:                          1  (97 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 6.86
//
[ok]

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory