Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_011022811.1 MA_RS15010 aspartate aminotransferase family protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >NCBI__GCF_000007345.1:WP_011022811.1 Length = 477 Score = 210 bits (534), Expect = 8e-59 Identities = 140/404 (34%), Positives = 206/404 (50%), Gaps = 34/404 (8%) Query: 23 PAAFIPVRGAGSRVWDQSGRELIDFAGGIAVNVLGHAHPALVAALTEQANKLWHVS-NVF 81 P + R GS + D G+E IDF GIAV GH++P + AA++ Q K+ H F Sbjct: 75 PYPLVVDRAKGSVIKDIDGKEYIDFIAGIAVMNSGHSNPEVNAAISAQLEKMVHCGYGDF 134 Query: 82 TNEPALRLAHKLVDATFAERVFFCNSGAEANEAAFKLARRVAHDRFGTEKYEIVAALNSF 141 EP L+LA KL + + +VF+CNSG EA EAA KLA + T++ +A N+F Sbjct: 135 FAEPPLKLAKKLRELSGYSKVFYCNSGTEAVEAAMKLAL------WKTKRPNFIAFYNAF 188 Query: 142 HGRTLFTVNVG-GQSKYSDGFGPKITGITHVPY---------------------NDLAAL 179 HGRTL +++ + + + F T TH Y +L Sbjct: 189 HGRTLGALSLTCSKVRQKEHFPTMRTVHTHYAYCYRCPLNLEYPSCGVECAKQIENLIFR 248 Query: 180 KAAVSDKTCAVVLEPIQGEGGVLPAELSYLQGARELCDAHNALLVFDEVQTGMGRSGKLF 239 K + T AV +EP+QGEGG + + + + +C ++ LL+ DEVQTG R+G Sbjct: 249 KELSPEDTAAVFIEPVQGEGGYIVPPQEFHKEVKRICTDNDVLLIADEVQTGCFRTGPFL 308 Query: 240 AYQHYGVTPDILTSAKSLGGGFPIAAMLTTEDLAKHLVVGTHGTTYGGNPLACAVAEAVI 299 A +++ V DI AK+LG G PI AML L G H T+GGN L+ A A A + Sbjct: 309 AMENFEVRADITCLAKALGAGLPIGAMLADSTL-MDWPPGVHSNTFGGNLLSSASALASL 367 Query: 300 DVINTPEVLNGVNAKHDKFKTRLEQIGEKYGLFTEVRGLGLLLGCVLSDAWKG----KAK 355 + + + N V + RL ++ E +VRGLGL++G + + K + Sbjct: 368 EFLEKENMENRVREMGTHIRQRLRELQENCPCIGDVRGLGLMIGAEIVKSDKSIDPIRRD 427 Query: 356 DIFNAAEREGLMILQAGPDVIRFAPSLVVEDADIDAGLDRFERA 399 I A +EG+++L G VIRF+P LV+ D + D GLD+FE+A Sbjct: 428 RIVREAFKEGVLLLPCGDSVIRFSPPLVMTDEEADLGLDKFEKA 471 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 477 Length adjustment: 32 Effective length of query: 374 Effective length of database: 445 Effective search space: 166430 Effective search space used: 166430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory