Align glutamyl-tRNA(Gln) amidotransferase subunit D (EC 6.3.5.7) (characterized)
to candidate WP_011021336.1 MA_RS06825 Glu-tRNA(Gln) amidotransferase subunit GatD
Query= metacyc::MONOMER-14998 (435 letters) >NCBI__GCF_000007345.1:WP_011021336.1 Length = 424 Score = 389 bits (999), Expect = e-113 Identities = 206/425 (48%), Positives = 277/425 (65%), Gaps = 23/425 (5%) Query: 19 GDMVLVEKPDVTYEGMVLDRADDADDRHIVLKLENGYNIGVEISDARIELLEKGSEP--- 75 GD V +E+ YEG V+ + +I +K+++GYN G I RI LLE E Sbjct: 6 GDWVRIERNGTVYEGKVMPSMEG----YITIKMKSGYNAGFSIDKVRITLLENNGETANG 61 Query: 76 -----------RIELPPVEAAEDPELPDVSIISTGGTVASIIDYRTGAVHPAFTADDLLR 124 ELP +LP ++I+STGGT+AS IDYRTGAV FTADD+L Sbjct: 62 SRNGGKGCKTNEEELPE----PGKKLPKIAILSTGGTIASKIDYRTGAVTSQFTADDILA 117 Query: 125 ANPELLDIANIRGRAVFNILSENMKPEYWVETARAVYGEIKDGADGVVVAHGTDTMHYTS 184 A PEL +IA+ +GR + +ILSENM + W ++AV EI+ GADGV+V HGTDTM Y++ Sbjct: 118 AIPELKEIADFKGRVISSILSENMDSDSWQNLSKAVVEEIEAGADGVIVTHGTDTMMYSA 177 Query: 185 AALSFMLRTPVPVVFTGAQRSSDRPSSDASLNIQCSVRAATSEIAEVTVCMHATMDDLSC 244 AALSFM++TPVP+VF G+QRS+DRPSSD ++N C+ R A S+IAEV V MH T D C Sbjct: 178 AALSFMIKTPVPIVFVGSQRSADRPSSDNAMNAICAARVAISDIAEVVVVMHGTTSDDFC 237 Query: 245 HLHRGVKVRKMHTSRRDTFRSMNALPLAEVTPDGIKILE-ENYRKRGSDELELSDRVEER 303 +HRG KVRK+HTSRRD F+S+N+LP+ V +I +Y +RG L+ +E + Sbjct: 238 EIHRGTKVRKLHTSRRDAFKSVNSLPVGTVDYGTGEIKTFIDYTRRGEKALKFKPGMEPK 297 Query: 304 VAFIKSYPGISPDIIKWHLDEGYRGIVIEGTGLGHCPDTLIPVIGEAHDMGVPVAMTSQC 363 A +K PG P ++ +++ GY+G+V+EGTGLGH IP++ +A D +PV +TSQC Sbjct: 298 CALVKFTPGADPTVLDYYISNGYKGLVVEGTGLGHISTKWIPLLRKATDAKMPVIVTSQC 357 Query: 364 LNGRVNMNVYSTGRRLLQAGVIPCDDMLPEVAYVKMCWVLGQTDDPEMAREMMRENIAGE 423 LNGR+ VY TGR +L+AG I +D LPE A VK+ WVLGQTDD E A M+RE+++GE Sbjct: 358 LNGRICDRVYDTGRDMLKAGAIEGEDTLPETALVKLMWVLGQTDDFEKAAGMLREDLSGE 417 Query: 424 INERT 428 I E T Sbjct: 418 ITECT 422 Lambda K H 0.318 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 538 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 435 Length of database: 424 Length adjustment: 32 Effective length of query: 403 Effective length of database: 392 Effective search space: 157976 Effective search space used: 157976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_011021336.1 MA_RS06825 (Glu-tRNA(Gln) amidotransferase subunit GatD)
to HMM TIGR02153 (gatD: glutamyl-tRNA(Gln) amidotransferase, subunit D (EC 6.3.5.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02153.hmm # target sequence database: /tmp/gapView.3711095.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02153 [M=405] Accession: TIGR02153 Description: gatD_arch: glutamyl-tRNA(Gln) amidotransferase, subunit D Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-183 596.4 0.1 1.3e-183 596.2 0.1 1.0 1 NCBI__GCF_000007345.1:WP_011021336.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000007345.1:WP_011021336.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 596.2 0.1 1.3e-183 1.3e-183 1 404 [. 17 423 .. 17 424 .] 0.97 Alignments for each domain: == domain 1 score: 596.2 bits; conditional E-value: 1.3e-183 TIGR02153 1 vfeGvvlpstelseediivlklknGYnvgvkkeeveeievleeekeek..........lekleeeiekkeele 63 v+eG v+ps +e++i++k+k+GYn g+++++v+ i++le++ e++ ++ ee +e+ ++l+ NCBI__GCF_000007345.1:WP_011021336.1 17 VYEGKVMPS----MEGYITIKMKSGYNAGFSIDKVR-ITLLENNGETAngsrnggkgcKTNEEELPEPGKKLP 84 79*******....78********************7.999999988878999**9996666667788999*** PP TIGR02153 64 kvsilstGGtiaskvdYetGavkpaltaeelleavpelkeianikaravlnilsenmkPesWikiaeevakal 136 k+ ilstGGtiask+dY+tGav++++ta+++l+a+pelkeia++k+r +++ilsenm+ +sW++++++v++++ NCBI__GCF_000007345.1:WP_011021336.1 85 KIAILSTGGTIASKIDYRTGAVTSQFTADDILAAIPELKEIADFKGRVISSILSENMDSDSWQNLSKAVVEEI 157 ************************************************************************* PP TIGR02153 137 eegadgvvvahGtDtmaytaaaLsFmlkklpvPvvlvGaqRssDRPssDaalnliaavkvakediaevvvvmh 209 e+gadgv+v+hGtDtm+y+aaaLsFm+k+ pvP+v+vG+qRs+DRPssD+a+n i+a++va +diaevvvvmh NCBI__GCF_000007345.1:WP_011021336.1 158 EAGADGVIVTHGTDTMMYSAAALSFMIKT-PVPIVFVGSQRSADRPSSDNAMNAICAARVAISDIAEVVVVMH 229 *****************************.******************************************* PP TIGR02153 210 getsDtyvlvhrgvkvrkmhtsRRDaFksinslPlakvdpkekeiellredyrkrgekelelkdkleekvalv 282 g+tsD+++++hrg+kvrk htsRRDaFks+nslP+++vd+ ++ei ++ dy++rgek l++k+++e k+alv NCBI__GCF_000007345.1:WP_011021336.1 230 GTTSDDFCEIHRGTKVRKLHTSRRDAFKSVNSLPVGTVDYGTGEI-KTFIDYTRRGEKALKFKPGMEPKCALV 301 ****************************************87665.56789********************** PP TIGR02153 283 kfyPGlspeilealvdkgykgivieGtGlGhvsedlievikkavddgvvvvmtsqclyGrvnlnvYstGRell 355 kf+PG +p +l++++++gykg+v+eGtGlGh+s+++i+ ++ka+d++++v++tsqcl+Gr++++vY+tGR++l NCBI__GCF_000007345.1:WP_011021336.1 302 KFTPGADPTVLDYYISNGYKGLVVEGTGLGHISTKWIPLLRKATDAKMPVIVTSQCLNGRICDRVYDTGRDML 374 ************************************************************************* PP TIGR02153 356 kaGvieaedmlpevayvklmwvLgqteeleevrkllkknlageieertl 404 kaG+ie+ed+lpe+a+vklmwvLgqt+++e++ +l+++l+gei+e+t+ NCBI__GCF_000007345.1:WP_011021336.1 375 KAGAIEGEDTLPETALVKLMWVLGQTDDFEKAAGMLREDLSGEITECTQ 423 *********************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (405 nodes) Target sequences: 1 (424 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 26.94 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory