Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_011022811.1 MA_RS15010 aspartate aminotransferase family protein
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_000007345.1:WP_011022811.1 Length = 477 Score = 213 bits (542), Expect = 9e-60 Identities = 143/405 (35%), Positives = 206/405 (50%), Gaps = 45/405 (11%) Query: 17 KTLDSGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAET 76 K + + V + L++ R +G+ + D +G EYID + G V N GH NPEV A+ Q E Sbjct: 66 KVMSACVSRPYPLVVDRAKGSVIKDIDGKEYIDFIAGIAVMNSGHSNPEVNAAISAQLEK 125 Query: 77 LMAMPQTLPTPMRGEFYRTLTAILPPEL------NRVFPVNSGTEANEAALKFARAHTGR 130 ++ G+F+ L +L ++VF NSGTEA EAA+K A T R Sbjct: 126 MVHCGY-------GDFFAEPPLKLAKKLRELSGYSKVFYCNSGTEAVEAAMKLALWKTKR 178 Query: 131 KKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEF-------------IPYNDVEA 177 F+A F GRT+G+LS+T ++ P + V P VE Sbjct: 179 PNFIAFYNAFHGRTLGALSLTCSKVRQKEHFPTMRTVHTHYAYCYRCPLNLEYPSCGVEC 238 Query: 178 LKRAVD---------EETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQ 228 K+ + E+TAAV +EPVQGEGG EF + + I + LLI DE+Q Sbjct: 239 AKQIENLIFRKELSPEDTAAVFIEPVQGEGGYIVPPQEFHKEVKRICTDNDVLLIADEVQ 298 Query: 229 TGMGRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGGHGTTFGGNP 288 TG RTG A E+F + DI LAKALG G+P+G A++ + P G H TFGGN Sbjct: 299 TGCFRTGPFLAMENFEVRADITCLAKALGAGLPIG-AMLADSTLMDWPPGVHSNTFGGNL 357 Query: 289 LAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPS--PKIREVRGMGLMVGLELKEK 346 L+ A+ +A++ +LE+ + R E+G ++LR + P I +VRG+GLM+G E+ + Sbjct: 358 LSSASALASLEFLEKENMENRVREMGTHIRQRLRELQENCPCIGDVRGLGLMIGAEIVKS 417 Query: 347 -------AAPYIARLEKEHRVLALQAGPTVIRFLPPLVIEKEDLE 384 I R + VL L G +VIRF PPLV+ E+ + Sbjct: 418 DKSIDPIRRDRIVREAFKEGVLLLPCGDSVIRFSPPLVMTDEEAD 462 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 453 Number of extensions: 23 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 477 Length adjustment: 32 Effective length of query: 363 Effective length of database: 445 Effective search space: 161535 Effective search space used: 161535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory