Align Ornithine aminotransferase; Orn-AT; Ornithine delta-aminotransferase; EC 2.6.1.13 (characterized)
to candidate WP_011022811.1 MA_RS15010 aspartate aminotransferase family protein
Query= SwissProt::O50131 (454 letters) >NCBI__GCF_000007345.1:WP_011022811.1 Length = 477 Score = 335 bits (858), Expect = 2e-96 Identities = 196/436 (44%), Positives = 274/436 (62%), Gaps = 14/436 (3%) Query: 9 EIPGPKARKVIEEHHKYMATTTNDPNEYFLVIERAEGVYWIDVDGNVLLDFSSGIGVMNV 68 ++ GP+AR++I + K M+ + P Y LV++RA+G D+DG +DF +GI VMN Sbjct: 51 DVVGPRAREIIGQDCKVMSACVSRP--YPLVVDRAKGSVIKDIDGKEYIDFIAGIAVMNS 108 Query: 69 GLRNPKVIEAIKKQLDLVLHAAGTDYYNPYQVELAKKLVEIAPGDIERKVFLSNSGTEAN 128 G NP+V AI QL+ ++H D++ ++LAKKL E++ KVF NSGTEA Sbjct: 109 GHSNPEVNAAISAQLEKMVHCGYGDFFAEPPLKLAKKLRELSGYS---KVFYCNSGTEAV 165 Query: 129 EAALKIAKWSTNRKMFIAFIGAFHGRTHGTMSLTASKPVQRSRMFPTMPGVVHVPYPNPY 188 EAA+K+A W T R FIAF AFHGRT G +SLT SK V++ FPTM VH Y Y Sbjct: 166 EAAMKLALWKTKRPNFIAFYNAFHGRTLGALSLTCSK-VRQKEHFPTMR-TVHTHYAYCY 223 Query: 189 RNPWGIDGYENPDELINRVIDYIEEYLFEHYVPAEEVAGIFFEPIQGEGGYVVPPKNFFK 248 R P ++ E + IE +F + E+ A +F EP+QGEGGY+VPP+ F K Sbjct: 224 RCPLNLEYPSCGVECAKQ----IENLIFRKELSPEDTAAVFIEPVQGEGGYIVPPQEFHK 279 Query: 249 ELKKLADKHGILLIDDEVQMGMGRTGRMWAIEHFDIVPDIVTVAKALGGGIPIGATIFRA 308 E+K++ + +LLI DEVQ G RTG A+E+F++ DI +AKALG G+PIGA + + Sbjct: 280 EVKRICTDNDVLLIADEVQTGCFRTGPFLAMENFEVRADITCLAKALGAGLPIGAMLADS 339 Query: 309 DLDFGVSGVHSNTFGGNTVAAAAALAVIEELQNGLIEN-AQKLEPLFRERLEEMKEKYEI 367 L GVHSNTFGGN +++A+ALA +E L+ +EN +++ R+RL E++E Sbjct: 340 TLMDWPPGVHSNTFGGNLLSSASALASLEFLEKENMENRVREMGTHIRQRLRELQENCPC 399 Query: 368 IGDVRGLGLAWGVEFVKDRKTKEYATKERGEIVVEALKRGLALLGCGKSAIRLIPPLIIS 427 IGDVRGLGL G E VK K+ + ++R IV EA K G+ LL CG S IR PPL+++ Sbjct: 400 IGDVRGLGLMIGAEIVKSDKSIDPIRRDR--IVREAFKEGVLLLPCGDSVIRFSPPLVMT 457 Query: 428 EEEAKMGLDIFEEAIK 443 +EEA +GLD FE+A++ Sbjct: 458 DEEADLGLDKFEKALR 473 Lambda K H 0.319 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 477 Length adjustment: 33 Effective length of query: 421 Effective length of database: 444 Effective search space: 186924 Effective search space used: 186924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory