Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_011022811.1 MA_RS15010 aspartate aminotransferase family protein
Query= curated2:Q8TUE8 (395 letters) >NCBI__GCF_000007345.1:WP_011022811.1 Length = 477 Score = 263 bits (671), Expect = 1e-74 Identities = 166/420 (39%), Positives = 242/420 (57%), Gaps = 38/420 (9%) Query: 11 PQARYDSVIEKDSKYVMQTYGRQ-PLVLSKGKGAVVQDIYGKEYIDCVAGIAVNNVGHCH 69 P+AR +I +D K + R PLV+ + KG+V++DI GKEYID +AGIAV N GH + Sbjct: 55 PRAR--EIIGQDCKVMSACVSRPYPLVVDRAKGSVIKDIDGKEYIDFIAGIAVMNSGHSN 112 Query: 70 PTVVKAIQAQAENLIHVS-NLYYTEIQAEFAETLASITGMERVFFCNSGAESVEAAMKLA 128 P V AI AQ E ++H ++ E + A+ L ++G +VF+CNSG E+VEAAMKLA Sbjct: 113 PEVNAAISAQLEKMVHCGYGDFFAEPPLKLAKKLRELSGYSKVFYCNSGTEAVEAAMKLA 172 Query: 129 RVATGKSAFVAAEHSFHGRTIGALSVTHKSMYRDPFMPPVSSETTFVPY----------- 177 T + F+A ++FHGRT+GALS+T + + P + + T Y Sbjct: 173 LWKTKRPNFIAFYNAFHGRTLGALSLTCSKVRQKEHFPTMRTVHTHYAYCYRCPLNLEYP 232 Query: 178 ----SDAEAIRQAI------SENTAAVILEPIQGEGGINIPDPGYLKEVREICDETGALL 227 A+ I I E+TAAV +EP+QGEGG +P + KEV+ IC + LL Sbjct: 233 SCGVECAKQIENLIFRKELSPEDTAAVFIEPVQGEGGYIVPPQEFHKEVKRICTDNDVLL 292 Query: 228 IFDEVQTGFGRTGTWFCKEQFGVEPDIMSMSKAIGGGFPMGAIAAHNGI-NFGRGQHAST 286 I DEVQTG RTG + E F V DI ++KA+G G P+GA+ A + + ++ G H++T Sbjct: 293 IADEVQTGCFRTGPFLAMENFEVRADITCLAKALGAGLPIGAMLADSTLMDWPPGVHSNT 352 Query: 287 FGGGPLACAAALASVKVIREEKLLERSKEMGAYFMKKLAGMVRD--DVVEVRGKGLMIGV 344 FGG L+ A+ALAS++ + +E + R +EMG + ++L + + + +VRG GLMIG Sbjct: 353 FGGNLLSSASALASLEFLEKENMENRVREMGTHIRQRLRELQENCPCIGDVRGLGLMIGA 412 Query: 345 EIKYPCGKFVDFAR---------EQGVLVNCTSDSVLRLVPPLVITKEQIDTVVDVLEQA 395 EI K +D R ++GVL+ DSV+R PPLV+T E+ D +D E+A Sbjct: 413 EI-VKSDKSIDPIRRDRIVREAFKEGVLLLPCGDSVIRFSPPLVMTDEEADLGLDKFEKA 471 Lambda K H 0.319 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 477 Length adjustment: 32 Effective length of query: 363 Effective length of database: 445 Effective search space: 161535 Effective search space used: 161535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory