Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_010961322.1 MCA_RS10180 aspartate aminotransferase family protein
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_000008325.1:WP_010961322.1 Length = 391 Score = 257 bits (657), Expect = 4e-73 Identities = 147/372 (39%), Positives = 209/372 (56%), Gaps = 10/372 (2%) Query: 24 YNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQT 83 Y + + G+GA ++D EG Y+D V G V +LGH +P V +A+ QA L+ Sbjct: 9 YARQPVTFTHGEGAWLFDTEGKRYLDAVSGVAVCSLGHAHPAVAKALCDQAGRLVHCSNL 68 Query: 84 LPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAHTGRK-----KFVAAMR 138 ++ + + L + ++ F NSG EANEAALK AR + + K V Sbjct: 69 YRIGLQEDLAKQLCDL--SGMDNAFFCNSGAEANEAALKIARRYGHHRGIDTPKIVVMEG 126 Query: 139 GFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGEG 198 F GRT+ +LS T PK +E F PLV +PY D EA+ D + AV++EPVQGEG Sbjct: 127 SFHGRTLATLSATGNPKVQEGFAPLVGGFVRLPYGDAEAVAAVDDPDVVAVLVEPVQGEG 186 Query: 199 GVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGG 258 GVR ++L + + + +G LL+LDE+QTGMGRTG+ F +H G+ PD++ LAKALG Sbjct: 187 GVRIPPDDYLARLKSLCERRGWLLMLDEVQTGMGRTGRMFGHQHTGVTPDVMALAKALGN 246 Query: 259 GVPLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFM 318 GVP+G + R A + G HG+TFGGNPLA AA +A I L R L +RA LG + Sbjct: 247 GVPIGACLARGVAAEMLTAGKHGSTFGGNPLACAAALAVIDTLTRQSLAQRAEILGQRLL 306 Query: 319 EKLRAIPS--PKIREVRGMGLMVGLELKEKAAPYIARLEKEHRVLALQAGPTVIRFLPPL 376 + R S P + E+RG+GLM+GLEL E+ + + E +L +R LPPL Sbjct: 307 DGFRTRLSGRPGVIEIRGLGLMIGLEL-ERPCTRLVGMALEQGLLINVTAERTVRLLPPL 365 Query: 377 VIEKEDLERVVE 388 ++ + +VE Sbjct: 366 ILTDAQADDLVE 377 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 391 Length adjustment: 31 Effective length of query: 364 Effective length of database: 360 Effective search space: 131040 Effective search space used: 131040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory