Align Probable 2-isopropylmalate synthase; EC 2.3.3.13; Alpha-IPM synthase; Alpha-isopropylmalate synthase (uncharacterized)
to candidate WP_010877238.1 MTH_RS07810 homocitrate synthase family protein
Query= curated2:Q8TYB1 (499 letters) >NCBI__GCF_000008645.1:WP_010877238.1 Length = 391 Score = 407 bits (1045), Expect = e-118 Identities = 206/373 (55%), Positives = 270/373 (72%) Query: 2 PDRVRIFDTTLRDGEQTPGVSLTVEEKVEIARKLDEFGVDTIEAGFPVASEGEFEAVRAI 61 PDR+ I+DTTLRDGEQTPGV L EEK+EIARKLDE G+ IE+GFPV SE E +V++I Sbjct: 17 PDRITIYDTTLRDGEQTPGVCLGTEEKLEIARKLDELGIHQIESGFPVVSEQERVSVKSI 76 Query: 62 AGEELDAEICGLARCVKGDIDAAIDADVDCVHVFIATSDIHLRYKLEMSREEALERAIEG 121 A E L+AEI L R K DIDAAID DVD V F+ATSD+HL++KL+++REEAL + Sbjct: 77 ANEGLNAEILALCRTKKDDIDAAIDCDVDGVITFMATSDLHLKHKLKLTREEALNVCMNS 136 Query: 122 VEYASDHGVTVEFSAEDATRTDRDYLLEVYKATVEAGADRVNVPDTVGVMTPPEMYRLTA 181 +EYA DHG+ + FSAEDATRTD D+L ++Y+ GADRV++ DTVG ++P M L Sbjct: 137 IEYAKDHGLFLAFSAEDATRTDLDFLKQIYRKAENYGADRVHIADTVGAISPQGMDYLVR 196 Query: 182 EVVDAVDVPVSVHCHNDFGMAVANSLAAVEAGAEQVHVTVNGIGERAGNASLEQVVMALK 241 E+ + V +++HCHNDFGMA++NS+A + AG V TVNGIGERAGN SLE+++MAL+ Sbjct: 197 ELRRDIKVDIALHCHNDFGMALSNSIAGLLAGGTAVSTTVNGIGERAGNTSLEELIMALR 256 Query: 242 ALYDIELDVRTEMLVELSRLVERLTGVVVPPNTPIVGENAFAHESGIHSHGVIKKAETYE 301 +Y+++L +L ELSRLVE+ T + VP N PIVG N F HESGIH VI++ TYE Sbjct: 257 IIYEVDLGFNIGVLYELSRLVEKHTRMKVPENKPIVGRNVFRHESGIHVDAVIEEPLTYE 316 Query: 302 PIRPEDVGHRRRIVLGKHAGRHAIKKKLEEMGIEVTEEQLDEIVRRVKELGDKGKRVTED 361 P PE +GH+R+IVLGKH+G A+K KLEE GI+VT ++L IV VK+ +KGK + ++ Sbjct: 317 PFLPEMIGHQRKIVLGKHSGCRAVKAKLEEYGIDVTRDELCRIVEEVKKNREKGKYINDE 376 Query: 362 DLEAIARDVVGEV 374 I + V G V Sbjct: 377 LFYRIVKSVRGPV 389 Lambda K H 0.315 0.133 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 25 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 499 Length of database: 391 Length adjustment: 32 Effective length of query: 467 Effective length of database: 359 Effective search space: 167653 Effective search space used: 167653 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory