Align 3-isopropylmalate/3-methylmalate dehydrogenase; 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; IPMDH; Beta-IPM dehydrogenase; D-malate dehydrogenase [decarboxylating]; EC 1.1.1.85; EC 1.1.1.n5; EC 1.1.1.83 (characterized)
to candidate WP_048061040.1 MTH_RS06640 3-isopropylmalate dehydrogenase
Query= SwissProt::Q58130 (333 letters) >NCBI__GCF_000008645.1:WP_048061040.1 Length = 326 Score = 379 bits (973), Expect = e-110 Identities = 198/332 (59%), Positives = 242/332 (72%), Gaps = 9/332 (2%) Query: 3 KICVIEGDGIGKEVVPATIQVLEATGLPFEFVYAEAGDEVYKRTGKALPEETIETALDCD 62 KI VI GDGIG EV+ A + +L L EF++A+AGD KRTG ALPEET+E + Sbjct: 2 KIAVIPGDGIGVEVMEAALHILNTLDLDLEFIHADAGDACLKRTGTALPEETLEAVGEAR 61 Query: 63 AVLFGAAGETAADVIVKLRHILDTYANIRPVKAYKGVKCLRPDIDYVIVRENTEGLYKGI 122 A LFGAAGE+AADVIV+LR D +AN+RPVK+ GV CL PD+D+VIVRENTE LY G Sbjct: 62 ATLFGAAGESAADVIVRLRREFDLFANLRPVKSLPGVPCLYPDLDFVIVRENTEDLYVGD 121 Query: 123 EAEIDEGITIATRVITEKACERIFRFAFNLARERKKMGKEG--KVTCAHKANVLKLTDGL 180 E EG +A R+IT A RI +FAF A+ KEG KVT HKANVLK TDG+ Sbjct: 122 EEYTPEG-AVAKRIITRTASRRISQFAFQYAQ------KEGMQKVTAVHKANVLKKTDGI 174 Query: 181 FKKIFYKVAEEYDDIKAEDYYIDAMNMYIITKPQVFDVVVTSNLFGDILSDGAAGTVGGL 240 F+ FYKVA EY ++A DYY+DA MY+IT+PQ F +VT+NLFGDILSD AAG +GGL Sbjct: 175 FRDEFYKVASEYPQMEATDYYVDATAMYLITQPQEFQTIVTTNLFGDILSDEAAGLIGGL 234 Query: 241 GLAPSANIGDEHGLFEPVHGSAPDIAGKKIANPTATILSAVLMLRYLGEYEAADKVEKAL 300 GLAPSANIG+++ LFEPVHGSAP IAGK IANPTA IL+ LML++L + + A K+EKAL Sbjct: 235 GLAPSANIGEKNALFEPVHGSAPQIAGKNIANPTAMILTTTLMLKHLNKKQEAQKIEKAL 294 Query: 301 EEVLALGLTTPDLGGNLNTFEMAEEVAKRVRE 332 ++ LA GL TPDLGG L T EMA E+A+ + + Sbjct: 295 QKTLAEGLVTPDLGGKLGTMEMAAEIARHLED 326 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 326 Length adjustment: 28 Effective length of query: 305 Effective length of database: 298 Effective search space: 90890 Effective search space used: 90890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory