Align cystathionine beta-synthase (O-acetyl-L-serine) (EC 2.5.1.134) (characterized)
to candidate WP_010963713.1 CA_RS02200 PLP-dependent aspartate aminotransferase family protein
Query= BRENDA::O05394 (379 letters) >NCBI__GCF_000008765.1:WP_010963713.1 Length = 377 Score = 400 bits (1029), Expect = e-116 Identities = 192/377 (50%), Positives = 272/377 (72%) Query: 1 MKKKTLMIHGGITGDEKTGAVSVPIYQVSTYKQPKAGQHTGYEYSRTANPTRTALEALVT 60 MK T +IH G GD+ TGA+S PIYQ ST+ Q H Y+Y+R+ NPTR ALE + Sbjct: 1 MKFGTKLIHSGFEGDKATGAISTPIYQTSTFHQENIDGHVTYDYARSGNPTREALENTIA 60 Query: 61 ELESGEAGYAFSSGMAAITAVMMLFNSGDHVVLTDDVYGGTYRVMTKVLNRLGIESTFVD 120 LE G G+AFSSGMAAI++V+ +F++ DH+++ DVYGGTYR+ T+ +R +E FVD Sbjct: 61 LLEGGYKGFAFSSGMAAISSVLSIFSAHDHIIVPKDVYGGTYRITTQFFSRFEVECEFVD 120 Query: 121 TSSREEVEKAIRPNTKAIYIETPTNPLLKITDLTLMADIAKKAGVLLIVDNTFNTPYFQQ 180 T+ EV++AI+ NTKAIYIETP+NPL+KITD+ + ++A++ +L+I DNTF +PY Q+ Sbjct: 121 TTDINEVQRAIKKNTKAIYIETPSNPLMKITDIRAIVELAREYKLLVIADNTFMSPYLQR 180 Query: 181 PLTLGADIVLHSATKYLGGHSDVVGGLVVTASKELGEELHFVQNSTGGVLGPQDSWLLMR 240 PL LGADIV+HSATK+L GHSD+V GLVV +KEL ++++FVQN+ G VL PQDSWLL+R Sbjct: 181 PLELGADIVVHSATKFLNGHSDIVAGLVVAKNKELADKIYFVQNAFGAVLSPQDSWLLLR 240 Query: 241 GIKTLGLRMEAIDQNARKIASFLENHPAVQTLYYPGSSNHPGHELAKTQGAGFGGMISFD 300 G+KTL +R+ NA ++A +L + V ++YPG +H G E+ +Q +G G ++SF+ Sbjct: 241 GMKTLKVRLNYQQNNATELAKWLLLNKFVDRVHYPGMPSHEGREIHLSQASGAGAVLSFE 300 Query: 301 IGSEERVDAFLGNLKLFTIAESLGAVESLISVPARMTHASIPRERRLELGITDGLIRISV 360 S E+ +F+ +K + SLG VE+++S PA+M+HA IP R++LGI D LIR+SV Sbjct: 301 ACSTEKAKSFMKKVKCAAVGVSLGGVETIVSYPAKMSHAEIPHNERIKLGIGDNLIRVSV 360 Query: 361 GIEDAEDLLEDIGQALE 377 G+ED EDL+E+ ALE Sbjct: 361 GLEDIEDLIENFKIALE 377 Lambda K H 0.316 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 377 Length adjustment: 30 Effective length of query: 349 Effective length of database: 347 Effective search space: 121103 Effective search space used: 121103 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory