Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_010966437.1 CA_RS16230 indole-3-glycerol phosphate synthase TrpC
Query= BRENDA::P00909 (453 letters) >NCBI__GCF_000008765.1:WP_010966437.1 Length = 262 Score = 160 bits (406), Expect = 3e-44 Identities = 101/250 (40%), Positives = 147/250 (58%), Gaps = 11/250 (4%) Query: 5 VLAKIVADKAIWVEARKQQQPLASFQ---NEVQPSTRHFYDALQGARTAFILECKKASPS 61 +L IV DK + + K+ L + N + R+F +AL+ + I E KKASPS Sbjct: 2 ILDDIVRDKKLQLIEDKKALSLDDIKSKLNSLNLDKRNFKEALEKENISIIAEIKKASPS 61 Query: 62 KGVIRDDFDPARIAAIYKHY-ASAISVLTDEKYFQGSFNFLPIVSQIAPQPILCKDFIID 120 KGVIR+DF+P +I IY++ A+S+LT++KYF G ++ IV ++ +PIL KDFI+D Sbjct: 62 KGVIREDFNPVKIGQIYENINIDAVSILTEKKYFLGKNEYIKIVKEVNSKPILRKDFIVD 121 Query: 121 PYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGV--LTEVSNEEEQERAIALG 178 YQ+Y A+ ADA LL+ +VL D + +LE+G+ +TEV NEEE + A +G Sbjct: 122 EYQLYEAKLIGADAVLLIAAVLKD---KLECFYNRTLELGLDSITEVHNEEEAKLASEIG 178 Query: 179 AKVVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVREL-SHFANGFLIG 237 ++GINNRDLRD S D+ T+ L + + ++SES I T + L S N LIG Sbjct: 179 CSIIGINNRDLRDFSTDITTTKRLMKYVPRDRIIVSESSIKTPEDILYLRSIGVNAVLIG 238 Query: 238 SALMAH-DDL 246 M + DDL Sbjct: 239 ETFMRNIDDL 248 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 262 Length adjustment: 29 Effective length of query: 424 Effective length of database: 233 Effective search space: 98792 Effective search space used: 98792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory