Align branched-chain amino acid aminotransferase 2; EC 2.6.1.42 (characterized)
to candidate WP_012170490.1 AZC_RS10175 D-amino-acid transaminase
Query= CharProtDB::CH_012531 (298 letters) >NCBI__GCF_000010525.1:WP_012170490.1 Length = 284 Score = 153 bits (386), Expect = 5e-42 Identities = 91/275 (33%), Positives = 144/275 (52%), Gaps = 10/275 (3%) Query: 7 FLNGEFVPKDEAKVSVYDHGYLYGDGVFEGIRVYSGNVFRLREHLVRLYESAKSIMLEIP 66 ++NG+FVP EA++S D G+L+ DG++E V G + HL RL S I L++P Sbjct: 6 YVNGDFVPLAEARISPLDRGFLFADGIYEVSAVLDGKLVDNDSHLARLKRSVGEIALDLP 65 Query: 67 YSLDEITNIVVETIRQNKLSNGYIRLVVSRGAGNLGLDPDSCTKPNVVVIAEQLSLFPQE 126 +L+E+ + E +R+N L+ G + + V+RG + KP + + ++ ++ + Sbjct: 66 VTLEELVELERELVRRNSLTEGVVYMQVTRGVADRDFTFPKDAKPTLFMFTQEKNILASK 125 Query: 127 YYEKGIPVVTVATRRNRPDV--LSPQVKSLNYLNNILVRIEAKLAGVQEALMLNDQGYVA 184 E GI V +V PD+ +KS+ L +L + A AG QEA M+ D G++ Sbjct: 126 AAETGIRVKSV------PDLRWARRDIKSVALLAQVLAKQAAAEAGCQEAWMVQD-GFIT 178 Query: 185 EGSGDNVFIVKGNK-LITPPSSAGALEGITRNAILEIGEKLGYDVREELFTRHDVYVADE 243 EG + FI+ N ++T P+S L G TR A+L + + V E LFT + A E Sbjct: 179 EGGSSSAFIITANDVVVTRPNSTAVLPGCTRRALLALAAEGTITVEERLFTLDEALAAKE 238 Query: 244 VFLTGTAAEVIAVTTVDGRTIGLGQTGPHTNRLLE 278 F+ ++ V AV +D + IG G GP T RL E Sbjct: 239 AFIASASSFVQAVVAIDDKPIGTGTPGPLTKRLRE 273 Lambda K H 0.317 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 284 Length adjustment: 26 Effective length of query: 272 Effective length of database: 258 Effective search space: 70176 Effective search space used: 70176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory