Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_010937030.1 DET_RS06870 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= metacyc::MONOMER-21143 (387 letters) >NCBI__GCF_000011905.1:WP_010937030.1 Length = 398 Score = 231 bits (589), Expect = 3e-65 Identities = 129/384 (33%), Positives = 214/384 (55%), Gaps = 9/384 (2%) Query: 4 AKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHGY 63 AK L+ G F + A+ G I LG+G+PDF TP H+ ++A AL++G+ Y Sbjct: 16 AKELKPSGIRKFFDLAAK------MGSGAISLGVGEPDFTTPWHIRESAIYALEKGYTMY 69 Query: 64 VLSNGILECRQAVTRKIKKLYNKDIDPE-RVLIMPGGKPTMYYAIQCFGEPGAEIIHPTP 122 + G+LE RQ + + + + Y + +PE +LI G + ++ PG E++ P Sbjct: 70 TSNAGLLELRQEIAKYLYQTYKLEYNPETEILITVGSSEALDLVMRATLNPGDEVLMTDP 129 Query: 123 AFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVEK 182 A+ Y S + PV E + + I IT KTR ++L P+NPTG+ + K Sbjct: 130 AYVAYPSCVFMAYGNPVQIPTFEANNFEISAADIAPRITPKTRSILLGYPSNPTGAVMPK 189 Query: 183 SAIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFNYPDLQDRLIVLDGWSKAYAMT 242 + + +A+ L ++ ++SDEIY + IY G E F P +++R ++++G+SK YAMT Sbjct: 190 AKLAEIAK-LACEKNLLVVSDEIYDKIIYSGFEHTCFATLPGMRERSVIINGFSKTYAMT 248 Query: 243 GWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRKL 302 GWR+G++ P ++I + K+ +++ C +Q A + AL D + M+ ++D+RR+ Sbjct: 249 GWRIGYAAGPADIIQAMTKIHQHTMLCAPIAAQKAALEALKNGHDDVRLMVEEYDRRRRF 308 Query: 303 IHEGLNSLPGVECSLPGGAFYAFPKVIGTGMNGSEFAKKCMHEAGVAIVPGTAFGKTCQD 362 I + N + G+ C P GAFY FP V TG++ +EFA+K + E VA VPGTAFG + + Sbjct: 309 IVKSFNDM-GLSCFEPKGAFYTFPSVKKTGLSSAEFAEKLLLEETVAAVPGTAFGDSGEG 367 Query: 363 YVRFSYAASQDNISNALENIKKML 386 Y+R YA S ++ A++ + L Sbjct: 368 YLRCCYATSMKDLEEAMKRFRHFL 391 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 398 Length adjustment: 31 Effective length of query: 356 Effective length of database: 367 Effective search space: 130652 Effective search space used: 130652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory