Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (characterized)
to candidate WP_010937030.1 DET_RS06870 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= SwissProt::Q2RK33 (390 letters) >NCBI__GCF_000011905.1:WP_010937030.1 Length = 398 Score = 213 bits (541), Expect = 1e-59 Identities = 125/381 (32%), Positives = 191/381 (50%), Gaps = 5/381 (1%) Query: 6 RIRELPPYLFARIEKKIAEARERGVDIISLGIGDPDMPTPSHVIDKLVAEAHNPENHRYP 65 R +EL P + I K A + G ISLG+G+PD TP H+ + + Y Sbjct: 15 RAKELKP---SGIRKFFDLAAKMGSGAISLGVGEPDFTTPWHIRESAIYALEKGYT-MYT 70 Query: 66 TSEGLLAFRQAVADWYQRLYGVDLDPRREVVTLIGSKEGIAHISLCYVDPGDINLVPDPG 125 ++ GLL RQ +A + + Y ++ +P E++ +GS E + + ++PGD L+ DP Sbjct: 71 SNAGLLELRQEIAKYLYQTYKLEYNPETEILITVGSSEALDLVMRATLNPGDEVLMTDPA 130 Query: 126 YPVYNIGTLLAGGESYFMPLTAANGFLPDLGAIPSDVARRAKLMFINYPNNPTGAVADLK 185 Y Y +A G +P AN F I + + + + + YP+NPTGAV Sbjct: 131 YVAYPSCVFMAYGNPVQIPTFEANNFEISAADIAPRITPKTRSILLGYPSNPTGAVMPKA 190 Query: 186 FFQEVVEFARSYDLIVCHDAAYSEITYDGYRAPSFLQAPGAKEVGIEFNSVSKPYNMTGW 245 E+ + A +L+V D Y +I Y G+ F PG +E + N SK Y MTGW Sbjct: 191 KLAEIAKLACEKNLLVVSDEIYDKIIYSGFEHTCFATLPGMRERSVIINGFSKTYAMTGW 250 Query: 246 RLGWACGRADVIEALARIKSNIDSGAFQAVQYAGIAALTGPQEGLAEVRRVYQERRDIIV 305 R+G+A G AD+I+A+ +I + A A Q A + AL + + + Y RR IV Sbjct: 251 RIGYAAGPADIIQAMTKIHQHTMLCAPIAAQKAALEALKNGHDDVRLMVEEYDRRRRFIV 310 Query: 306 EGFNSLGWHLEKPKATFYVWAPVPR-GYTSASFAEMVLEKAGVIITPGNGYGNYGEGYFR 364 + FN +G +PK FY + V + G +SA FAE +L + V PG +G+ GEGY R Sbjct: 311 KSFNDMGLSCFEPKGAFYTFPSVKKTGLSSAEFAEKLLLEETVAAVPGTAFGDSGEGYLR 370 Query: 365 IALTISKERMQEAIERLRRVL 385 S + ++EA++R R L Sbjct: 371 CCYATSMKDLEEAMKRFRHFL 391 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 398 Length adjustment: 31 Effective length of query: 359 Effective length of database: 367 Effective search space: 131753 Effective search space used: 131753 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory