Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_010937030.1 DET_RS06870 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_000011905.1:WP_010937030.1 Length = 398 Score = 306 bits (783), Expect = 9e-88 Identities = 158/380 (41%), Positives = 240/380 (63%), Gaps = 5/380 (1%) Query: 5 LNPKAREIEISGIRKFSNLVAQH-EDVISLTIGQPDFFTPHHVKAAAKKAIDENVTSYTP 63 ++ +A+E++ SGIRKF +L A+ ISL +G+PDF TP H++ +A A+++ T YT Sbjct: 12 ISDRAKELKPSGIRKFFDLAAKMGSGAISLGVGEPDFTTPWHIRESAIYALEKGYTMYTS 71 Query: 64 NAGYLELRQAVQLYMKKKADFNYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPGPIY 123 NAG LELRQ + Y+ + Y+ E+EI+IT G+S+A+D R L+PGDEV+M P Y Sbjct: 72 NAGLLELRQEIAKYLYQTYKLEYNPETEILITVGSSEALDLVMRATLNPGDEVLMTDPAY 131 Query: 124 PGYEPIINLCGAKPVIVDT-TSHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEE 182 Y + + PV + T ++ F+++A I +TP T+ ++L YPSNPTG + + + Sbjct: 132 VAYPSCVFMAYGNPVQIPTFEANNFEISAADIAPRITPKTRSILLGYPSNPTGAVMPKAK 191 Query: 183 LKSIAALLKGRNVFVLSDEIYSELTYDR-PHYSIATY--LRDQTIVINGLSKSHSMTGWR 239 L IA L +N+ V+SDEIY ++ Y H AT +R+++++ING SK+++MTGWR Sbjct: 192 LAEIAKLACEKNLLVVSDEIYDKIIYSGFEHTCFATLPGMRERSVIINGFSKTYAMTGWR 251 Query: 240 IGFLFAPKDIAKHILKVHQYNVSCASSISQKAALEAVTNGFDDALIMREQYKKRLDYVYD 299 IG+ P DI + + K+HQ+ + CA +QKAALEA+ NG DD +M E+Y +R ++ Sbjct: 252 IGYAAGPADIIQAMTKIHQHTMLCAPIAAQKAALEALKNGHDDVRLMVEEYDRRRRFIVK 311 Query: 300 RLVSMGLDVVKPSGAFYIFPSIKSFGMTSFDFSMALLEDAGVALVPGSSFSTYGEGYVRL 359 MGL +P GAFY FPS+K G++S +F+ LL + VA VPG++F GEGY+R Sbjct: 312 SFNDMGLSCFEPKGAFYTFPSVKKTGLSSAEFAEKLLLEETVAAVPGTAFGDSGEGYLRC 371 Query: 360 SFACSMDTLREGLDRLELFV 379 +A SM L E + R F+ Sbjct: 372 CYATSMKDLEEAMKRFRHFL 391 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 398 Length adjustment: 31 Effective length of query: 362 Effective length of database: 367 Effective search space: 132854 Effective search space used: 132854 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory