Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_010936475.1 DET_RS03860 LL-diaminopimelate aminotransferase
Query= BRENDA::Q8YTF2 (403 letters) >NCBI__GCF_000011905.1:WP_010936475.1 Length = 388 Score = 358 bits (920), Expect = e-103 Identities = 172/376 (45%), Positives = 246/376 (65%) Query: 11 RIQQLPPYVFARLDELKAKAREQGIDLIDLGMGNPDGATPQPVVDAAIQALQDPKNHGYP 70 RI+ LPPY+F ++ + A+ R +G ++I +G+PD TP+ ++ +A +DP NH YP Sbjct: 6 RIENLPPYLFVQISKKIAEKRAKGEEVISFAIGDPDLPTPKHILAELCKAAEDPANHRYP 65 Query: 71 PFEGTASFRRAITNWYNRRYGVVLDPDSEALPLLGSKEGLSHLAIAYVNPGDVVLVPSPA 130 EG R+A+ WY +R+GV L+PD+E LPL+GSKEG+ H A +++PGDV LVP PA Sbjct: 66 ETEGLPVLRKAMAEWYEKRFGVKLNPDTEVLPLIGSKEGIGHAAWCFLDPGDVALVPDPA 125 Query: 131 YPAHFRGPVIAGGTVHSLILKPENDWLIDLTAIPEEVARKAKILYFNYPSNPTGATAPRE 190 YP + +AG V + L EN++L D AIP++V KAKIL+ NYP+NPTGA A + Sbjct: 126 YPVYAISSQLAGAEVFYMPLNKENNFLPDFNAIPQDVLSKAKILWINYPNNPTGAVAGLD 185 Query: 191 FFEEIVAFARKYEILLVHDLCYAELAFDGYQPTSLLEIPGAKDIGVEFHTLSKTYNMAGW 250 FF+E FA K+ + + HD Y+E+AFDGY+P S LE GAK++G+EFH+LSK+YNM GW Sbjct: 186 FFKEAAEFAAKHNLAVCHDGPYSEIAFDGYRPVSFLEADGAKEVGIEFHSLSKSYNMTGW 245 Query: 251 RVGFVVGNRHVIQGLRTLKTNLDYGIFAALQTAAETALQLPDIYLHEVQQRYRTRRDFLI 310 R+G VGN +I LR K+NLD GI A+Q A AL + + Y+ RRD L+ Sbjct: 246 RIGMAVGNAKMIDALRRFKSNLDSGIPQAIQLMAIAALNGSQDVISQNCAVYQRRRDRLV 305 Query: 311 QGLGELGWDVPKTKATMYLWVKCPVGMGSTDFALNLLQQTGVVVTPGNAFGVAGEGYVRI 370 + L +G +V KA++Y+W P G S FA LL +TGVVVTPG +G +GEGY+R+ Sbjct: 306 EALRNIGMEVTAPKASLYIWAPVPEGYTSASFATELLDKTGVVVTPGTGYGTSGEGYIRL 365 Query: 371 SLIADCDRLGEALDRI 386 SL ++L + + ++ Sbjct: 366 SLTVPDEQLEKGIAKL 381 Lambda K H 0.321 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 488 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 388 Length adjustment: 31 Effective length of query: 372 Effective length of database: 357 Effective search space: 132804 Effective search space used: 132804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory