Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_011373519.1 SUDEN_RS09890 LL-diaminopimelate aminotransferase
Query= BRENDA::D2Z0I0 (402 letters) >NCBI__GCF_000012965.1:WP_011373519.1 Length = 405 Score = 410 bits (1054), Expect = e-119 Identities = 205/402 (50%), Positives = 278/402 (69%), Gaps = 4/402 (0%) Query: 1 MSEEWMFPKVKKLPKYVFAMVNELKYQLRREGEDIVDLGMGNPDIPPSQHIIDKLCEVAN 60 M +E F ++K+LPKYVFA VNELK RR G D++D MGNPD +HI +KL E A Sbjct: 1 MFDEIQFDRMKRLPKYVFAEVNELKMAERRAGVDVIDFSMGNPDGDTPEHIREKLIESAQ 60 Query: 61 RPNVHGYSASKGIPRLRKAICDFYKRRYGVELDPERNAIMTIGAKEGYSHLMLAMLEPGD 120 + HGYS SKGIP+L AI D+YKRRY +LDP + T+G+KEGY+HL A+ PGD Sbjct: 61 KTRTHGYSVSKGIPKLLVAIADWYKRRYDCDLDPSTECVATMGSKEGYAHLAYAITNPGD 120 Query: 121 TVIVPNPTYPIHYYAPIICGGDAISVPILPEEDF---PEVFLRRLYDLIKTSFRKPKAVV 177 IVP+PTYPIH Y+ I+ GG+ I +ED+ + F L + K S KPK V+ Sbjct: 121 VAIVPDPTYPIHEYSFILAGGNVSKFGIEFDEDYRLNEDKFFEDLDRVFKESSPKPKFVL 180 Query: 178 LSFPHNPTTLCVDLEFFQEVVKLAKQEGIWIVHDFAYADLGFDGYTPPSILQVEGALDVA 237 ++FPHNPTT V +F+ +V +AK++ +++ D AY D+ FDGY PSI+ VEGA DVA Sbjct: 181 VNFPHNPTTATVTQDFYVRLVAMAKEKRFYVISDIAYGDITFDGYVTPSIMSVEGAKDVA 240 Query: 238 VELYSMSKGFSMAGWRVAFVVGNEMLIKNLAHLKSYLDYGVFTPIQVASIIALESPYEVV 297 VE +++SK ++MAGWRV F VGN+ LI L +KS+LDYG+FTPIQVA+ IAL + V Sbjct: 241 VESFTLSKSYNMAGWRVGFFVGNKKLIGALQKIKSWLDYGMFTPIQVAATIALNGDQQCV 300 Query: 298 EKNREIYRRRRDVLVEGLNRVGWEVKKPKGSMFVWAKVPEE-VGMNSLDFSLFLLREAKV 356 + + Y R++VL++ +R GW +KK + SMFVWAK+P+ + + SL+FS LL+EA V Sbjct: 301 KDITDKYNHRQEVLLDAFDRAGWHIKKNQASMFVWAKIPDYCLHLGSLEFSKKLLKEAGV 360 Query: 357 AVSPGIGFGEYGEGYVRFALVENEHRIRQAVRGIKKALDKIK 398 AV+PGIGFG YG+ YVR AL+EN++RIRQA R IK+ L + + Sbjct: 361 AVAPGIGFGVYGDEYVRIALIENDNRIRQAARNIKEFLKQFQ 402 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 405 Length adjustment: 31 Effective length of query: 371 Effective length of database: 374 Effective search space: 138754 Effective search space used: 138754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory