Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25); 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate WP_011391360.1 RRU_RS18660 shikimate dehydrogenase
Query= BRENDA::A0A5H2X4C4 (538 letters) >NCBI__GCF_000013085.1:WP_011391360.1 Length = 283 Score = 119 bits (299), Expect = 1e-31 Identities = 98/274 (35%), Positives = 136/274 (49%), Gaps = 23/274 (8%) Query: 261 KVFGIIGKPVGHSKSPLLYNQAFKSAGFDGVFLHLLV--DDVASFLQTYSSTDFAGFSCT 318 +V G+IG PVGHS+SP L+ G DG ++ L V + + L + AG + T Sbjct: 7 RVAGVIGWPVGHSRSPRLHGFWLARHGIDGAYVPLAVAPEALERALAALPALGLAGVNVT 66 Query: 319 IPHKEAAVKCCDEVDPVAKSIGAVNCIIRRQSDAKLFGYNTDYVGAISAIEDGLRGSQNG 378 +PHKE A+ D + A+ IGAVN I+ QSD +L G NTD G + + LR + Sbjct: 67 VPHKEHALARMDALTERARRIGAVNTIV-CQSDGRLLGDNTDGFGFL----ENLRQRRPD 121 Query: 379 NSAGASPLNGKLFVVIGAGGAGKALGYGAKEKGA-RVVIANRTYDRARELAETIGGDA-- 435 AG P VV+GAGGA +A+ E G + + NR RAR LAE + + Sbjct: 122 WRAGHGPA-----VVLGAGGAARAVCASLLEAGCPALTLVNRDQGRARALAEALAAWSPV 176 Query: 436 -LSLADLENFHPEDG--MILANTTSIGM--QPKVDETPIPKHALKHYSLVFDAVYTPKIT 490 ++LA + G +L NTTS+GM QP +D + L +LV D VY P T Sbjct: 177 PITLATWDEAPRTLGGAALLVNTTSLGMVGQPPLD---LDLRGLAPSALVTDIVYAPLET 233 Query: 491 RLLKEAEECGATIVSGLEMFIGQAYGQYERYTGL 524 LL A G V GL M + Q +E + G+ Sbjct: 234 PLLARARALGLATVDGLGMLLHQGRPGFEAWFGV 267 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 538 Length of database: 283 Length adjustment: 30 Effective length of query: 508 Effective length of database: 253 Effective search space: 128524 Effective search space used: 128524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory