Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_011390962.1 RRU_RS16580 O-succinylhomoserine sulfhydrylase
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_000013085.1:WP_011390962.1 Length = 413 Score = 351 bits (900), Expect = e-101 Identities = 182/384 (47%), Positives = 245/384 (63%), Gaps = 1/384 (0%) Query: 20 DTLAVRAGQRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGNVYSRYTNPTVRTFE 79 DTL VR G RT E EALF S YV+ A +A A F G + VYSR+ NPT+ FE Sbjct: 27 DTLLVRGGLARTGLNETSEALFLNSGYVYPNAEEAEAAFDGTLERYVYSRFRNPTISVFE 86 Query: 80 ERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGIQ 139 ER+AALEGA ATASGM+A+ + ++ +GD V+ +R +FGS + ++G+ Sbjct: 87 ERLAALEGAPVCKATASGMAAVTSALLCQVRAGDRVVAARDLFGSCSWVIGDLLAQYGVS 146 Query: 140 VDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLAVDNCFCT 199 ++ +L AW A T+ F+E+PSNP +VD+ + ++AHA GA + VDN F T Sbjct: 147 AEFVDTENLDAWAQALAKPTRAVFLETPSNPTLRIVDLKGVCDLAHAAGATVVVDNAFAT 206 Query: 200 PALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEVVG-FLRTAGPTLSPFNA 258 P LQ+P GADVV+HSATK+IDGQGR +GG V + +G FLR GP L+PFNA Sbjct: 207 PLLQRPRDFGADVVVHSATKWIDGQGRCLGGAVLCDEAFNETYLGPFLRHTGPCLAPFNA 266 Query: 259 WLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQQSGFGA 318 W+ LKGLETL +R+ HSA+AL LA +E P + R Y GL SHP+H LA+ Q G Sbjct: 267 WVMLKGLETLSLRINRHSATALTLAGLIEGHPAVARALYPGLASHPRHALAQSQMKAGGG 326 Query: 319 VVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAGIGDS 378 V++ +KGGR +A+RF++A +V I+ NLGD K+ HP TT+H RLSPE++ GI + Sbjct: 327 VIALSLKGGRASAYRFLNALSIVDISNNLGDAKSLACHPWTTTHQRLSPEEKLIQGIDEG 386 Query: 379 LIRVAVGLEDLDDLKADMARGLAA 402 LIR +VGLED +DL AD+ L A Sbjct: 387 LIRFSVGLEDPEDLAADIGAALDA 410 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 413 Length adjustment: 31 Effective length of query: 372 Effective length of database: 382 Effective search space: 142104 Effective search space used: 142104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory