Align Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 (characterized)
to candidate WP_014626023.1 RRU_RS04110 PLP-dependent transferase
Query= SwissProt::P9WGB7 (388 letters) >NCBI__GCF_000013085.1:WP_014626023.1 Length = 439 Score = 223 bits (569), Expect = 6e-63 Identities = 150/431 (34%), Positives = 216/431 (50%), Gaps = 59/431 (13%) Query: 10 GISGPATRAIHAG-YRPDPATGAVNVPIYASSTFAQDGVGGLRGGFE-------YARTGN 61 G+ P T A+H G YR DP TG+V VPIY ++++ + G F Y+R N Sbjct: 12 GLKNPETLALHGGTYRADPTTGSVAVPIYQTTSYQFENTGQAARLFALQELGNIYSRLTN 71 Query: 62 PTRAALEASLAAVEEGAFARAFSSGMAATDCALRAMLRPGDHVVIPDDAYGGTFRLIDKV 121 PT A E +AA+E G A A SSG AA+ A+ + + GD++V D YGGT+ L Sbjct: 72 PTTDAFEQRIAAIEGGVAALAVSSGQAASTFAVLNLAQAGDNIVSSTDLYGGTWALFAST 131 Query: 122 FTRWDVQYTPVRLADLDAVGAAITPRTRLIWVETPTNPLLSIADITAIAELGTDRSAKVL 181 F ++ ++ V D + A RTR + ET NP L++ I +A++G ++ Sbjct: 132 FKQFGIEVRFVDPTDPENFRKATDERTRAYYAETLPNPKLNVFPIREVADIGRSLGVPLI 191 Query: 182 VDNTFASPALQQPLRLGADVVLHSTTKYIGGHSDVVGGALVTND----EELDEEFAFL-- 235 VDNT A+P + +P GA VV++STTKYIGGH +GG ++ + E+ + F L Sbjct: 192 VDNT-AAPLIARPFDHGAAVVVYSTTKYIGGHGTTIGGVIIDSGTFPWEDFPDRFPTLTE 250 Query: 236 ----QNGA--------------------------GAVPGPFDAYLTMRGLKTLVLRMQRH 265 +GA GA P + ++GL+TL LR+++H Sbjct: 251 PDESYHGAVWTEATKPLGPVAYIIRARVKLLRDVGAAISPLAVFQLIQGLETLPLRIRQH 310 Query: 266 SENACAVAEFLADHPSVSSVLYPGLPSHPGHEIA-ARQMRGFGGMVSVRMRAGRRAAQDL 324 +ENA VA FL DHP ++ V+YPGL + A A G+GG+V + G A + Sbjct: 311 NENALKVATFLKDHPKIARVIYPGLQTGELRRRADAYLTGGYGGLVGFELHGGAEAGRAF 370 Query: 325 CAKTRVFILAESLGGVESLIEHPSAMTHASTAGSQLEVPDDL--------VRLSVGIEDI 376 R+F ++G SL HP+ TH SQL D L VRLS+GIE Sbjct: 371 IESLRLFYHVANIGDARSLAIHPATTTH-----SQLSEEDQLLTGVTPGYVRLSIGIEHP 425 Query: 377 ADLLGDLEQAL 387 AD++ DL QAL Sbjct: 426 ADIIEDLSQAL 436 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 388 Length of database: 439 Length adjustment: 31 Effective length of query: 357 Effective length of database: 408 Effective search space: 145656 Effective search space used: 145656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory