Align Probable adenylyltransferase/sulfurtransferase MoeZ; EC 2.7.7.-; EC 2.8.1.- (characterized)
to candidate WP_011443665.1 SARO_RS00010 HesA/MoeB/ThiF family protein
Query= SwissProt::P9WMN7 (392 letters) >NCBI__GCF_000013325.1:WP_011443665.1 Length = 264 Score = 163 bits (413), Expect = 5e-45 Identities = 94/256 (36%), Positives = 149/256 (58%), Gaps = 8/256 (3%) Query: 7 PLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGV 66 P + PA L+ + + R++RH+++P++G GQ RL + V+++G GG+G+P L YLA AGV Sbjct: 4 PALSPA--LTPDRLDRFARHIVLPEVGAIGQARLAASHVVLVGMGGIGSPALQYLAGAGV 61 Query: 67 GTIGIVDFDVVDESNLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELRLAPSNA 126 G + ++D DVV+ SNLQRQ I+ D+G+ KAQ+A + +P + V H R+ NA Sbjct: 62 GRLTLIDDDVVEASNLQRQTIYTEEDLGKPKAQAAAAWVARFDPALEVVHHVTRIGRENA 121 Query: 127 VDLFKQYDLILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAPDGLGVN 186 DL D++LDG+DNFATR V+DA V G ++ RF+GQ + F P Sbjct: 122 ADLIAGADVVLDGSDNFATRLSVSDACVSVGVALSSVALGRFQGQVANFAGHRPG--EAC 179 Query: 187 YRDLYPEPPPPGMVPSCAEGGVLGIICASVASVMGTEAIKL----ITGIGETLLGRLLVY 242 YR + +CA+ GVLG + + + A+++ ++ +G+ G+L V+ Sbjct: 180 YRCFVGDAFDAEDCDTCADLGVLGAMVGMIGAFGAMAAMRVLLEGVSTLGDPQWGQLHVF 239 Query: 243 DALEMSYRTITIRKDP 258 D L+ S RT+ I +DP Sbjct: 240 DGLKPSLRTMRIARDP 255 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 264 Length adjustment: 28 Effective length of query: 364 Effective length of database: 236 Effective search space: 85904 Effective search space used: 85904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory