Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate WP_011906689.1 SARO_RS18085 aminotransferase
Query= BRENDA::P9WPZ5 (397 letters) >NCBI__GCF_000013325.1:WP_011906689.1 Length = 393 Score = 258 bits (659), Expect = 2e-73 Identities = 168/392 (42%), Positives = 218/392 (55%), Gaps = 19/392 (4%) Query: 3 VSRLRP-YA---TTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYP 58 + RL P YA T+F MS LA +GA+NLGQGFPDE PP +L+A A A +QYP Sbjct: 5 LQRLHPVYAGMPVTIFEHMSGLARELGAINLGQGFPDEAPPPALLEALSRAAAERSHQYP 64 Query: 59 PGPGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPF 118 P G LRRA+A G++ E+ V+VT GATEA+A A+L V PG EVLL P Sbjct: 65 PMAGIPELRRAVAGFYAWTQGLEVGAES-VIVTSGATEAVACAILAAVAPGDEVLLFSPA 123 Query: 119 YDSYSPVVAMAGAHRVTVPLVPDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSA 178 YD+Y+P++ AG V VPL P + D A+ AVTPRTRAL++N P NPTG V + Sbjct: 124 YDAYAPLIRRAGGVPVFVPLSPPH--WRYDEAAIVAAVTPRTRALVLNDPLNPTGTVAAD 181 Query: 179 TELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTG 238 TELA IA + V +L+ I DEV+E++ FD RH L GMA RTI I SA K+F TG Sbjct: 182 TELAMIASLCVRHDLIAICDEVWENVRFDGRRHRSLLALPGMARRTIKIGSAGKIFGATG 241 Query: 239 WKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRL 298 WK+GW ++ A + A Q+L++ Q AVA L+ + A A R L Sbjct: 242 WKVGWMVAAPDMAAVLARAHQFLTFTTAPMLQWAVAQGLE-DPALAAGCTARWAETRGVL 300 Query: 299 AAGLTEIGFAVHDSYGTYFLCADPRPLG--YDDSTEFCAALPEKVGVAAIPMSAFCDPAA 356 L GF V D+ T+F C D G DD T F + GVA+IP+SA + Sbjct: 301 IEALGRRGFTVLDTTATWFTCIDLAASGIALDDRT-FSDRAVREAGVASIPLSALWE--- 356 Query: 357 GQASQQADVWNHLVRFTFCKRDDTLDEAIRRL 388 G A+ + +VR CK + L EA+ RL Sbjct: 357 GDAAPEG-----IVRLCHCKPEAMLLEAMDRL 383 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 471 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 393 Length adjustment: 31 Effective length of query: 366 Effective length of database: 362 Effective search space: 132492 Effective search space used: 132492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory