Align Aromatic-amino-acid aminotransferase 1; ARAT-I; AROAT; EC 2.6.1.57 (characterized)
to candidate WP_041755911.1 PST_RS11765 PLP-dependent aminotransferase family protein
Query= SwissProt::H3ZPL1 (417 letters) >NCBI__GCF_000013785.1:WP_041755911.1 Length = 388 Score = 250 bits (639), Expect = 5e-71 Identities = 144/393 (36%), Positives = 219/393 (55%), Gaps = 15/393 (3%) Query: 22 FSEKALGMKASEIRELLKLVETSDVISLAGGLPAPETFPVEIIGEITKEVLEKHAAQALQ 81 FSE+ +K+S IRE+L + +V+S AGGLPA P E+ A Q Sbjct: 3 FSERITRLKSSLIREILAAAQRPEVMSFAGGLPAEAMLPAVDWAELP--------ASMGQ 54 Query: 82 YGTTKGFTPLRLALAEWMRERYDIPISKVDIMTTSGSQQALDLIGRVFINPGDIIVVEAP 141 YG ++G LR A+A R +P ++ SGSQQ LDL ++FI+ G ++VEAP Sbjct: 55 YGMSEGEPALREAIAAQARA-LGVPCEASQVLIVSGSQQTLDLASKLFIDSGTEVLVEAP 113 Query: 142 TYLAALQAFKYYEPEFVQIPLDDEGMNVDLLEEKLQELEKEGKKVKIVYTIPTFQNPAGV 201 TYLAALQ+F+ + + + + +G ++ L L++ Y IPTFQNP+ V Sbjct: 114 TYLAALQSFQLFGAQCLAVAQKADGPDLAALRAMLEQ-----HAPAFAYLIPTFQNPSAV 168 Query: 202 TMNEKRRKRLLELASQYDFIIVEDNPYGELRYSGEPVKPIKAWDEEGRVIYLGTFSKILA 261 +E +R+ + +L +Y ++ED PY EL + +PI + + IY GT SK L Sbjct: 169 RYSEAKREAVADLLDEYGVTLLEDEPYRELVFDQGSARPIVSRLKRASWIYTGTVSKTLL 228 Query: 262 PGFRIGWIAAEPHFIRKLEIAKQSVDLCTNTFSQVIAWKYVEGGYLDKHIPKIIEFYKPR 321 PG R+G++ A L KQS DL TN Q A +++ + H+ ++ EFY+ R Sbjct: 229 PGLRVGYLIASADLFPYLLRLKQSADLHTNRIGQWQALQWLGSDHYQAHLGQLREFYRVR 288 Query: 322 RDAMLKALEEFMPDGVKWTKPEGGMFVWATLPEGIDTKLMLEKAVAKGVAYVPGEAFFAH 381 RDAM AL E D W P+GG+F W TL + +DT+ +L +A+A+ V ++PGE FF Sbjct: 289 RDAMQAALTEHFSDLATWELPQGGLFFWLTLKQPLDTRTLLNRALAEDVVFMPGEPFFVE 348 Query: 382 RDVK-NTMRLNFTYVPEEKIREGIKRLAETIKE 413 D +RLNF++V E++ EG++RLA+ I++ Sbjct: 349 PDANPGYLRLNFSHVAAERMDEGLRRLAQVIRD 381 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 388 Length adjustment: 31 Effective length of query: 386 Effective length of database: 357 Effective search space: 137802 Effective search space used: 137802 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory