Align Cystathionine gamma-lyase; CGL; CSE; Cysteine desulfhydrase; Cysteine-protein sulfhydrase; Gamma-cystathionase; Homocysteine desulfhydrase; EC 4.4.1.1; EC 4.4.1.2 (characterized)
to candidate WP_011735676.1 PPRO_RS08900 homocysteine synthase
Query= SwissProt::Q55DV9 (387 letters) >NCBI__GCF_000015045.1:WP_011735676.1 Length = 428 Score = 241 bits (616), Expect = 2e-68 Identities = 147/417 (35%), Positives = 222/417 (53%), Gaps = 40/417 (9%) Query: 9 IGTNVIHAGQSADKNTGAVIVPISLSTTFLQPSP-------GVLHSEYDYSRSGNPTRKA 61 I T +HAGQS D T + VPI +++++ + G+ Y+R NPT Sbjct: 8 IETLALHAGQSPDSETLSRAVPIYQTSSYVFRNSEHAANLFGLKEPGNIYTRLMNPTTDV 67 Query: 62 FEECIAACENAKYALSFASGLATLT-TITHLLKSGDEVISIDDVYGGTRRYFTRVAANFD 120 E +AA + AL+ ASG A +T + ++ +G ++S +YGGT F Sbjct: 68 LERRMAALDGGVGALAVASGQAAITYAVLNITSAGQNIVSTSFLYGGTYNLFHYTLPRLG 127 Query: 121 LKFSFVDLSTLDDLKNAFTDKTRLVWIETPTNPLLKVADIKAVADYVHSRGATLVVDNTF 180 ++ FVD S ++++ A TRLV+ E+ NP V D +A+A H G LVVDNT Sbjct: 128 IQVKFVDSSDPENIRRAIDQDTRLVYSESVGNPKNNVDDFEAIAAIAHEAGIPLVVDNTV 187 Query: 181 MSPYFQNPLDLGADIVMHSVTKYINGHSDCVMGVLA---------------TNNDELYAK 225 +P+ PLD GADIV++S+TK+I GH + G + T D Y Sbjct: 188 TTPWLFKPLDHGADIVVYSLTKFIAGHGTSIGGAIVDGGTFNWDNGRFPELTEPDPSYHG 247 Query: 226 LKF----------------LQNSIGAVPSPFDCFLALRGLKTLHVRMEAHQKNAFAICNF 269 LK+ L +GA SPF+ F L+GL+TLHVRM H +NA + ++ Sbjct: 248 LKYWEALGSQAYILKMRVTLLRDMGACLSPFNSFQILQGLETLHVRMPRHVENARCVASW 307 Query: 270 LEKHPKVERVIYPGLPSHPQHEICKRQM-KGYGGMVVFFVKGSIDQSRSFLENIKLFALA 328 LE+HP V V YPGL SH H ++ + KG G ++ F +KG + F++N+KL + Sbjct: 308 LERHPLVSWVNYPGLASHRDHANARKYLPKGEGAIIGFGIKGGVKAGSKFIDNVKLLSHL 367 Query: 329 ESLGGVESLIELPSVMTHASVPAEERAKLGISDTLIRLSVGIEDINDLLADISQALD 385 ++G +SL+ P+ TH + EE+ G+S IRLS+G+E+I+D++ADISQAL+ Sbjct: 368 ANIGDAKSLVIHPASTTHQQLSEEEQLASGVSPDFIRLSIGLENIDDIIADISQALE 424 Lambda K H 0.320 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 428 Length adjustment: 31 Effective length of query: 356 Effective length of database: 397 Effective search space: 141332 Effective search space used: 141332 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory