Align cystathionine beta-synthase (O-acetyl-L-serine) (EC 2.5.1.134) (characterized)
to candidate WP_011735719.1 PPRO_RS09115 PLP-dependent aspartate aminotransferase family protein
Query= BRENDA::O05394 (379 letters) >NCBI__GCF_000015045.1:WP_011735719.1 Length = 383 Score = 399 bits (1024), Expect = e-116 Identities = 189/375 (50%), Positives = 265/375 (70%) Query: 1 MKKKTLMIHGGITGDEKTGAVSVPIYQVSTYKQPKAGQHTGYEYSRTANPTRTALEALVT 60 M T + G+ D +TGA+S+PIYQ +T++ P GQ TG++YSR+ NPTR ALE + Sbjct: 1 MNIDTQAVQTGLEWDTRTGALSIPIYQSATFRHPGLGQSTGFDYSRSGNPTRLALEQGIA 60 Query: 61 ELESGEAGYAFSSGMAAITAVMMLFNSGDHVVLTDDVYGGTYRVMTKVLNRLGIESTFVD 120 ++ G G+AFSSGMAAIT++++LF GDH+V+T+D+YGGT R+ ++ R G+ ++VD Sbjct: 61 RMDGGSRGFAFSSGMAAITSLLLLFQEGDHLVVTEDLYGGTCRLFDRIFTRFGLSFSYVD 120 Query: 121 TSSREEVEKAIRPNTKAIYIETPTNPLLKITDLTLMADIAKKAGVLLIVDNTFNTPYFQQ 180 T+ REEV AI P+TKA+++ET TNPLLK D+ ++ I + G+LLI DNTF TPY + Sbjct: 121 TTDREEVLAAITPSTKALFVETLTNPLLKFADIPALSTICHERGLLLIADNTFLTPYLLR 180 Query: 181 PLTLGADIVLHSATKYLGGHSDVVGGLVVTASKELGEELHFVQNSTGGVLGPQDSWLLMR 240 PL GADI ++SATKYL GH+D V GL V +L E+++F QNS G VLGPQDSWL++R Sbjct: 181 PLERGADITVYSATKYLSGHNDTVAGLAVVRDPQLAEQVYFHQNSAGAVLGPQDSWLVIR 240 Query: 241 GIKTLGLRMEAIDQNARKIASFLENHPAVQTLYYPGSSNHPGHELAKTQGAGFGGMISFD 300 G+KTLG+R++ +NA KIA +L+ HP V ++YPG HP H+L + GFG MI+F+ Sbjct: 241 GMKTLGVRLDRQQENALKIARWLQRHPQVTRVHYPGLEEHPDHDLIRRHARGFGAMIAFE 300 Query: 301 IGSEERVDAFLGNLKLFTIAESLGAVESLISVPARMTHASIPRERRLELGITDGLIRISV 360 + S V+ L +L + AESLG VE+L++ P THA IP E R LGI D L+R+SV Sbjct: 301 VESHSLVEQLLLRTQLISFAESLGGVETLMTFPEGQTHADIPPELRARLGINDVLLRLSV 360 Query: 361 GIEDAEDLLEDIGQA 375 GIE+ +DL++D+ QA Sbjct: 361 GIENVDDLIDDLNQA 375 Lambda K H 0.316 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 383 Length adjustment: 30 Effective length of query: 349 Effective length of database: 353 Effective search space: 123197 Effective search space used: 123197 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory