Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate WP_011778652.1 MVAN_RS07020 carbamate kinase
Query= BRENDA::Q59281 (294 letters) >NCBI__GCF_000015305.1:WP_011778652.1 Length = 314 Score = 42.0 bits (97), Expect = 2e-08 Identities = 67/273 (24%), Positives = 105/273 (38%), Gaps = 45/273 (16%) Query: 9 VVVKYGGNA-------MVDDDLKAAFAADMVFLRTV--GAKPVVVHGGGPQISEM----- 54 +V+ GGNA M D+ + + + TV G + V+ HG GPQ+ + Sbjct: 3 IVIALGGNAILRRGQPMTADNQRENIRSAAQSIATVAEGNQLVIAHGNGPQVGLLALQAA 62 Query: 55 ---------LNRVGLQGEFKGGFRV------TTPEVMDIVRMVLFGQVGRDLVGLINSHG 99 L+ +G Q E G+ + P + ++ +V N Sbjct: 63 SYHDVAPYPLDVLGAQTEAMIGYVIEQELGNVLPPEQPLATVLTMIEVAPADPAFANPTK 122 Query: 100 PYAVGTSGEDAGLFTAQK-----------RMVNIDGVPTDIGLVGDIIN-VDASSLMDII 147 P + A A R V P I +G I V+ +++ Sbjct: 123 PIGPVYDRQTADAMHAASGWTFAPDGEHFRRVIASPKPKRIFEIGPIRTLVEHGTMVICA 182 Query: 148 EAGRIPVVSTIAPGEDGQIYNINADTAAGALAAAIGAERLLVLTNVEGLYTDW--PDKSS 205 G IP V G I+ D A+ LA + A+ L++ T+V+G+YT W PD+ Sbjct: 183 GGGGIPTVYDGQGRLQGVEAVIDKDLASALLAEQLHADMLVIATDVDGVYTGWGTPDQRR 242 Query: 206 LVSKIKATELEAILPGLDSGMIPKMESCLNAVR 238 L S+I ELE + S M PK+E+ VR Sbjct: 243 L-SRITPDELETMHFAAGS-MGPKVEAACRFVR 273 Lambda K H 0.319 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 294 Length of database: 314 Length adjustment: 27 Effective length of query: 267 Effective length of database: 287 Effective search space: 76629 Effective search space used: 76629 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory