Align δ1-pyrroline-5-carboxylate synthetase (EC 1.2.1.41; EC 2.7.2.11) (characterized)
to candidate WP_011814631.1 HHAL_RS09315 glutamate 5-kinase
Query= metacyc::AT2G39800-MONOMER (717 letters) >NCBI__GCF_000015585.1:WP_011814631.1 Length = 376 Score = 124 bits (311), Expect = 8e-33 Identities = 96/290 (33%), Positives = 142/290 (48%), Gaps = 38/290 (13%) Query: 6 RSRAFARDVKRIVVKVGTAVVTGKGGRLALGRLGALCEQLAELNSDGFEVILVSSGAVGL 65 R R R +R V+KVG+A++T G LA ++ A +Q+A L G +V LVSSGAV Sbjct: 2 RRREALRQAQRWVIKVGSALITDDGRGLAHEQMSAWADQVAALRKAGRQVTLVSSGAVAE 61 Query: 66 GRQRLRYRQLVNSSFADLQKPQTELDGKACAGVGQSSLMAYYETMFDQLDVTAAQLLVND 125 G QRL +R +P+ +A AGVGQS L+ + + + AQ+L+ Sbjct: 62 GMQRLGWR----------SRPRALYQLQAAAGVGQSGLVHAWSDGLARHRLQTAQVLLTH 111 Query: 126 SSFRDKDFRKQLNETVKSMLDLRVIPIFNENDAISTRRAPYQDSSGIFWDNDSLAALLAL 185 D+ ++ ML L V+P+ NEND + T F DND+LAAL+A Sbjct: 112 DDLSDRRRYLNARSALREMLRLGVVPVVNENDTVVTDEIR-------FGDNDTLAALVAN 164 Query: 186 ELKADLLILLSDVEGLYTGPPSD-PNSKLIHTFVKEKHQDEITFGDKSR----------L 234 ++A+ L++L+D GL P + P++ L+ DE+ GD L Sbjct: 165 LVEAEALVVLTDQPGLMDRDPREHPDAVLL---------DEVRAGDPELERLCGSPAGVL 215 Query: 235 GRGGMTAKVKAAVNAAYAGIPVIITSGYSAENIDKVLRG-LRVGTLFHQD 283 GRGGM KV+ A AA +G ++ SG I ++ +GTLF D Sbjct: 216 GRGGMLTKVRGAERAARSGTYTVVASGREGRVIQRLADAEPGLGTLFVPD 265 Lambda K H 0.318 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 543 Number of extensions: 38 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 717 Length of database: 376 Length adjustment: 35 Effective length of query: 682 Effective length of database: 341 Effective search space: 232562 Effective search space used: 232562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory