Align Probable succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; EC 3.5.1.18 (uncharacterized)
to candidate WP_011841302.1 RSPH17029_RS09495 acetylornithine deacetylase
Query= curated2:Q5HKI1 (405 letters) >NCBI__GCF_000015985.1:WP_011841302.1 Length = 387 Score = 87.8 bits (216), Expect = 5e-22 Identities = 66/210 (31%), Positives = 108/210 (51%), Gaps = 15/210 (7%) Query: 11 RLLADIVKIQT-ENDHEIEVCEYLKDLLSQYDIDS-KIVKVNDSRANLVAEIG---SGAP 65 ++L +V T D + + +++++ L I + ++ ++A L A +G GA Sbjct: 9 QILERLVAFPTVSRDSNLALVDWVEEFLEGAGITAHRVWNEERTKAALYAHVGPEVDGAV 68 Query: 66 VLAISGHMDVVDAGDHDDWTFPPFELTDKDGKLFGRGTTDMKGGLMAMVIAMIELKQSNA 125 VL SGH DVV + DW+ P+ LT++DG+L+GRGT DMK G A+ +A + L Q Sbjct: 69 VL--SGHTDVVPV-EGQDWSSDPWTLTERDGRLYGRGTCDMK-GFDALALAALALAQETG 124 Query: 126 LKQGTIRLLATTGEETEQYGAQLLADE--GYLDDVSGLIIGEPTSNIAYYAHKGSMSCVV 183 +K+ +++ + EE GA + DE L +I+GEP+ HKG + Sbjct: 125 VKR-PLQIALSFDEEVGCLGAPAMIDEMARCLPKGRAVIVGEPSRMQVVTGHKGGGGLIC 183 Query: 184 TAKGKAAHSSMPHLGTNAV---DILVDFVN 210 +G HSS+ H G NA+ L+D+ N Sbjct: 184 QVQGHEVHSSIMHRGVNAIMSAARLIDWAN 213 Lambda K H 0.316 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 387 Length adjustment: 31 Effective length of query: 374 Effective length of database: 356 Effective search space: 133144 Effective search space used: 133144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory