Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_011337028.1 RSPH17029_RS02525 aspartate kinase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000015985.1:WP_011337028.1 Length = 419 Score = 280 bits (717), Expect = 8e-80 Identities = 154/414 (37%), Positives = 259/414 (62%), Gaps = 16/414 (3%) Query: 340 VVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTTDHLIELAKTIDENPD 399 ++VMKFGG +++D+ +++ A+K+ + + G +V++SAM T+ L+ + D Sbjct: 3 LLVMKFGGTSVADLARIKNAAQKVKREVERGYDVIVIVSAMSGKTNELVGWVEQTSPLFD 62 Query: 400 PRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKRYGSARIIDINTDIIS 459 RE D ++S+GE + LM++ L++ A S+ G Q+ I T ++ +AR ++I + + Sbjct: 63 AREYDAVVSSGENVTAGLMALTLQEMEVPARSWQGWQVPIRTTSQHSAARFLEIPRENLD 122 Query: 460 RYLKQDF-IPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGADLCELYKDVDGVYTA 518 + F + VVAGFQG++ G ITTLGRGGSD TA+A A + A+ C++Y DVDGVYT Sbjct: 123 AKFAEGFKVAVVAGFQGVSPEGRITTLGRGGSDTTAVAFAAAFAAERCDIYTDVDGVYTT 182 Query: 519 DPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVLIKNAHK---ETRGT 575 DPRI AR ++++++EEM+EL+ GA+VLQ R+ E A +Y VK+ + ++ + ET GT Sbjct: 183 DPRIASKARKLEKIAYEEMLELASLGAKVLQTRSVELAMRYKVKLRVLSSFEDTDETSGT 242 Query: 576 LIWEGTKV-ENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGVNIDMIIQGMK 634 L+ + + E+ +V V + AK+ L V D+PGVAA I L++ GVN+DMI+Q + Sbjct: 243 LVCDEEDIMESKVVSGVAYSRDEAKMTLVTVEDRPGVAAAIFGPLAEAGVNVDMIVQNIS 302 Query: 635 SGEYNT-------VAFIVPESQLGKLDIDLLKTRSEA----KEIIIEKGLAKVSIVGVNL 683 +Y + + F P +Q+ + L ++E +++++ +AKVS+VG+ + Sbjct: 303 EKDYGSHPGSVTDMTFSCPINQVARARKALEDAKAEGTIVYDDLVVDTEVAKVSVVGIGM 362 Query: 684 TSTPEISATLFETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELD 737 S ++AT+F+ LA +G+NI +I+ S +ISV+ID KY+E AV+A+H F L+ Sbjct: 363 RSHAGVAATMFKALAADGVNIKVIATSEIKISVLIDRKYMELAVQALHDAFALE 416 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 636 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 419 Length adjustment: 36 Effective length of query: 703 Effective length of database: 383 Effective search space: 269249 Effective search space used: 269249 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory