Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate WP_011840643.1 RSPH17029_RS04315 4-aminobutyrate--2-oxoglutarate transaminase
Query= SwissProt::Q5JEW1 (445 letters) >NCBI__GCF_000015985.1:WP_011840643.1 Length = 425 Score = 257 bits (657), Expect = 4e-73 Identities = 151/413 (36%), Positives = 222/413 (53%), Gaps = 21/413 (5%) Query: 38 IVIERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFYE 97 I +R ++D++G + DFA+G+ V+N GH HP+V+ A+ +Q +FTH YE Sbjct: 24 IYADRALNAEIWDIEGRRYIDFAAGIAVVNTGHCHPKVMAAVAEQMGRFTHTCHQVLPYE 83 Query: 98 NAIILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLVKYGTGRKQFLAFYHAFHGRTQA 157 N I LAE+L APGD +K V+ +GAE+ E A+K+ + TGR +AF FHGRT Sbjct: 84 NYIRLAERLNAAAPGDFAKKTVFVTTGAESVENAIKIARIHTGRSAVVAFGGGFHGRTFM 143 Query: 158 VLSLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLDFIEEYVFR 217 +SLT + GF MP V H+P+P GI T + + Sbjct: 144 TMSLTGKVEPYKKGFGTMMPEVYHVPFPQALH---GIS--------TEEAMAALARLFKA 192 Query: 218 HVPPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGIGRTGKFWA 277 + P + AI FEP+QGEGG+ P +A+++ D +GI++ DEVQ G RTG +A Sbjct: 193 DLDPGRVAAIIFEPVQGEGGFYPAPPDLVRAIRQLCDAHGIVMIADEVQTGFARTGTLFA 252 Query: 278 IEHFGVEPDLIQFGKAIGGGLPLAGVIHRADI-TFDKPGRHATTFGGNPVAIAAGIEVVE 336 + + V PDL+ K +GGGLP+A V RA+I PG T+GGNP+ IAA V++ Sbjct: 253 MHGYDVAPDLVTMAKGLGGGLPIAAVTGRAEIMDAAHPGGLGGTYGGNPLGIAAAHAVLD 312 Query: 337 IVKE--LLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAVEIVKSKETKEKYPE-- 392 +++E L E+G L + L E + I D RG G E + K P+ Sbjct: 313 VIEEENLCARATELGSRLKQKLAEIRATAPEIADIRGPGFMVGAEFA---DPGSKAPDAG 369 Query: 393 LRDRIVKESAKRGLVLLGCG--DNSIRFIPPLIVTKEEIDVAMEIFEEALKAA 443 +R+ +E+ KRGL+LL CG N IRF+ P+ + + A+EI E ++ AA Sbjct: 370 FTNRVREEALKRGLILLTCGVHGNVIRFLAPITIPEPHFAEALEILEASVAAA 422 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 514 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 425 Length adjustment: 32 Effective length of query: 413 Effective length of database: 393 Effective search space: 162309 Effective search space used: 162309 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory