GapMind for Amino acid biosynthesis

 

Alignments for a candidate for gatC in Methanococcus maripaludis C5

Align Probable glutamyl-tRNA(Gln) amidotransferase subunit C; Glu-ADT subunit C; EC 6.3.5.- (uncharacterized)
to candidate WP_011868791.1 MMARC5_RS05220 Asp-tRNA(Asn) amidotransferase subunit GatC

Query= curated2:Q57694
         (82 letters)



>NCBI__GCF_000016125.1:WP_011868791.1
          Length = 79

 Score = 81.3 bits (199), Expect = 2e-21
 Identities = 38/75 (50%), Positives = 56/75 (74%), Gaps = 1/75 (1%)

Query: 6  IEKIKKEAEEIINKFSEVLEKFNLEMEESYYIIDTRNVLREDEAVESNPEFREKFLKIAP 65
          +EKI+K+A+EI+ + SEVLE F+LE EE Y+I++T+NVLR+D+    +  F+   L +AP
Sbjct: 4  VEKIQKQADEIVAQLSEVLENFDLETEEEYHILETKNVLRDDDEAFLDESFKNDALNVAP 63

Query: 66 KVNKEGYVVVEKGSW 80
          KV K+G +VVEK  W
Sbjct: 64 KV-KDGSIVVEKSKW 77


Lambda     K      H
   0.310    0.131    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 35
Number of extensions: 2
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 82
Length of database: 79
Length adjustment: 8
Effective length of query: 74
Effective length of database: 71
Effective search space:     5254
Effective search space used:     5254
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 38 (19.9 bits)
S2: 38 (19.2 bits)

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory