Align asparagine-oxo-acid transaminase (EC 2.6.1.14); alanine-glyoxylate transaminase (EC 2.6.1.44); serine-glyoxylate transaminase (EC 2.6.1.45) (characterized)
to candidate WP_011868998.1 MMARC5_RS06310 alanine--glyoxylate aminotransferase family protein
Query= BRENDA::Q56YA5 (401 letters) >NCBI__GCF_000016125.1:WP_011868998.1 Length = 382 Score = 219 bits (557), Expect = 1e-61 Identities = 125/381 (32%), Positives = 208/381 (54%), Gaps = 8/381 (2%) Query: 12 LFVPGPVNIPEPVIRAMNRNNEDYRSPAIPALTKTLLEDVKKIFKTTSGTPFLFPTTGTG 71 L +PGP +P V+ M +R+ LT+ ++ +K++F+T + T ++ +GT Sbjct: 10 LMIPGPTMVPSRVLNTMALPIIGHRTKDFGDLTEDTVDKMKEVFQTKNDT-YIITGSGTA 68 Query: 72 AWESALTNTLSPGDRIVSFLIGQFSLLWIDQQKRLNFNVDVVESDWGQGANLQVLASKLS 131 + A++NTL D++++ G F + + E +WG A+ Q L L Sbjct: 69 VMDMAISNTLDKDDKVINITNGNFGERFYKISSVYKADTIKYEPEWGSLADPQKLKELL- 127 Query: 132 QDENHTIKAICIVHNETATGVTNDISAVRTLLDHYKHPALLLVDGVSSICALDFRMDEWG 191 +EN +KA+ +VHNET+TG N I + ++ + A+ +VD +SS+ +D++ Sbjct: 128 -EENEDVKAVTVVHNETSTGAKNPIEDLGNVVKDFN--AIYIVDTISSLGGDYVDVDKFN 184 Query: 192 VDVALTGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTP 251 +D+ +TGSQK ++ P GL + KA + +++ + D N Y K + PYTP Sbjct: 185 IDICVTGSQKCIAAPPGLAAITVGEKAWDVVSKTETKSFYLDLNAYKKSWDSKKETPYTP 244 Query: 252 SIQLLYGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAV 311 S+ L Y + AL+++ +EGLEN + RH L +ATR +EA GL+ KEE S TVT+ Sbjct: 245 SVSLTYAMNEALEMVLDEGLENRVKRHDLLARATRAGLEAMGLE-LFAKEEARSVTVTSA 303 Query: 312 MVPPHIDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILK 371 P ID + ++YN+ + G + +AGK+FR+GH+G+ E Q+LG LA +E+ K Sbjct: 304 KYPEGIDDKKFRGLLAEKYNIRVAGGQSHLAGKIFRVGHMGSAKEYQVLGTLAAIELTFK 363 Query: 372 DVGYPVVMGSGVAAASTYLQH 392 ++GY GVAAA L + Sbjct: 364 ELGY--TAEGGVAAAKKVLSN 382 Lambda K H 0.320 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 382 Length adjustment: 31 Effective length of query: 370 Effective length of database: 351 Effective search space: 129870 Effective search space used: 129870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory