Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_012567165.1 RC1_RS09530 cystathionine gamma-synthase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000016185.1:WP_012567165.1 Length = 387 Score = 535 bits (1379), Expect = e-157 Identities = 255/376 (67%), Positives = 311/376 (82%) Query: 18 ATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEHQGFEYSRTHNPTRFAYERCVAALE 77 +T AIH GQ PDP+TGA+M PIY TSTY Q SPG H+GFEYSR+ NPTRFAYERCVA LE Sbjct: 11 STRAIHAGQEPDPATGAIMVPIYQTSTYVQESPGVHKGFEYSRSQNPTRFAYERCVADLE 70 Query: 78 GGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGLDFSFVDLT 137 G R FAFASG+A +TV+ELLD+GSHVVA DD+YGG++RLFERVR+RTAGL FSFVD+ Sbjct: 71 SGHRGFAFASGLAGEATVLELLDSGSHVVATDDIYGGSYRLFERVRKRTAGLSFSFVDVA 130 Query: 138 DPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQRPL 197 D AA +AAIR +T+M+W+ETPTNP+LKL D+ A+A + R+ GL+TV DNTFASP +QRPL Sbjct: 131 DLAAVEAAIRPETRMIWVETPTNPLLKLADLEALAQLGRRRGLITVCDNTFASPWVQRPL 190 Query: 198 SLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGPFDSFLALRG 257 LG D+V HSATKYLNGHSDMVGG+ VV + EL++++ FLQN++G +QGPFDSFLALRG Sbjct: 191 ELGFDIVTHSATKYLNGHSDMVGGLVVVREAGELSDRLGFLQNAVGAIQGPFDSFLALRG 250 Query: 258 LKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMSGFGGIVSIVL 317 LKTL LRM HC+NAL +A+WLE HPA+ +V YP L SHPQH LA+RQM+ GG+V+I L Sbjct: 251 LKTLALRMERHCQNALVVAEWLERHPAVARVRYPFLPSHPQHELARRQMAAGGGMVTIHL 310 Query: 318 KGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVRLSV 377 KGG + A+R E+TELF LAESLGGVESL+ HPA+MTHASIP +R LGI D +VRLSV Sbjct: 311 KGGLEPARRMLERTELFALAESLGGVESLIEHPAIMTHASIPADQRAALGIDDGMVRLSV 370 Query: 378 GIEDLGDLRGDLERAL 393 G+E++ DL DLE+AL Sbjct: 371 GVEEVDDLLADLEQAL 386 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 578 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 387 Length adjustment: 31 Effective length of query: 366 Effective length of database: 356 Effective search space: 130296 Effective search space used: 130296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory