Align Homocitrate synthase AksA; EC 2.3.3.14; (R)-homo(2)citrate synthase; EC 2.3.3.-; (R)-homo(3)citrate synthase; EC 2.3.3.- (uncharacterized)
to candidate WP_012566191.1 RC1_RS04635 citramalate synthase
Query= curated2:Q8TW28 (397 letters) >NCBI__GCF_000016185.1:WP_012566191.1 Length = 547 Score = 183 bits (464), Expect = 1e-50 Identities = 135/373 (36%), Positives = 186/373 (49%), Gaps = 28/373 (7%) Query: 13 MDLPDEVIVYDTTLRDGEQTPGVSFTPEQKLEIAHLLDELGVQQIEAGFPVVSEGERDAV 72 M+ + V +YDTTLRDG QT GV F K+ IA LD LG+ +E G+P + + DA Sbjct: 1 MNETNRVYLYDTTLRDGAQTSGVDFGVADKIAIARELDALGIDYVEGGWPGANPTD-DAF 59 Query: 73 RRIAHEGLNADILCLARTLR--------GDVDAALDCDVDGVITFIATSELHLKHKLRMS 124 A T R G + A L+ V + + H+ L +S Sbjct: 60 FAAPPALARATFTAFGMTRRPGRSAANDGGLAALLNSGAPAVCIVGKSWDFHVDVALGIS 119 Query: 125 REEVLERIADTVEYAKDHGLWVAFSAE---DGTRTEFEFLERVYRTAEECGADRVHATDT 181 R E LE I D+V G F AE DG R EF + A E GA + DT Sbjct: 120 RTENLELIRDSVAAIVARGREALFDAEHFFDGYRRNPEFALSCVQAAHEAGARWIVLCDT 179 Query: 182 VGVMIPAAMRLFVAKI-REVVDLPIGVHCHDDFGMAVANSLAAVEAGAQAISTTVNGIGE 240 G +P + VA++ R + +G+HCH+D AVANSLAAV AGA+ I T+NG+GE Sbjct: 180 NGGTLPHEIERIVAEVARSIPGGRLGIHCHNDTENAVANSLAAVRAGARMIQGTLNGLGE 239 Query: 241 RAGNAALEEVIMALKELYGIDPGFNTEVLAELSRKVSEYSGIDVPPNKA------VVGEN 294 R GNA L ++ L G + G A+L R V +D N+A VGE+ Sbjct: 240 RCGNANLVSLLPTLMLKLGYETGV---ARADLKRLVHVSRMLDERMNRAPNRHAPYVGES 296 Query: 295 AFRHESGIHVAAVLEEPRTYEPIDPKEVGMNRKIVLGKHTGRKAVVAKLEELGVEPEE-- 352 AF H+ G+HV+AV ++P YE IDP VG R I++ GR V+A+L E+G+E + Sbjct: 297 AFAHKGGLHVSAVEKDPACYEHIDPDLVGNRRHILVSDQAGRSNVLARLREVGLEVDPGD 356 Query: 353 ----EIVEEVLKR 361 ++VE V +R Sbjct: 357 GRIGQLVEAVKRR 369 Lambda K H 0.317 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 516 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 547 Length adjustment: 33 Effective length of query: 364 Effective length of database: 514 Effective search space: 187096 Effective search space used: 187096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory