GapMind for Amino acid biosynthesis

 

Alignments for a candidate for B12-reactivation-domain in Rhodospirillum centenum SW SW; ATCC 51521

Align candidate WP_049766682.1 RC1_RS09810 (methionine synthase)
to HMM PF02965 (Met_synt_B12)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/PF02965.21.hmm
# target sequence database:        /tmp/gapView.3481320.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       Met_synt_B12  [M=273]
Accession:   PF02965.21
Description: Vitamin B12 dependent methionine synthase, activation domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                             -----------
   1.5e-133  430.4   0.0   2.2e-133  429.9   0.0    1.3  1  NCBI__GCF_000016185.1:WP_049766682.1  


Domain annotation for each sequence (and alignments):
>> NCBI__GCF_000016185.1:WP_049766682.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  429.9   0.0  2.2e-133  2.2e-133       1     273 []     598     872 ..     598     872 .. 0.99

  Alignments for each domain:
  == domain 1  score: 429.9 bits;  conditional E-value: 2.2e-133
                          Met_synt_B12   1 dleelveyidWtpffqaWelkgkypkiledekvgeeakklfkdAqamLkkiieekllkakavvglfpAnsegd 73 
                                           dl+el++ idW++ff+aWel+g++p+il+de vge+a+ lfkdAq mL++ii ek+l+a++v+glfpAns+gd
  NCBI__GCF_000016185.1:WP_049766682.1 598 DLAELATRIDWKFFFEAWELAGSFPAILDDEIVGESARGLFKDAQVMLQRIIGEKWLTARGVIGLFPANSVGD 670
                                           689********************************************************************** PP

                          Met_synt_B12  74 dievyadesrseelatlhtLrqqaeke..egkpnlclaDfvapkesgvkDyiGlFavtaglgieelakefeae 144
                                           d+e+y+desr+++l++lh+Lrqq+++e  +++++lclaDf+apk+sgv D+iG Favtag+g+ee a++fea+
  NCBI__GCF_000016185.1:WP_049766682.1 671 DVEIYTDESRTTVLTRLHFLRQQMAREpgRERAHLCLADFIAPKQSGVPDWIGSFAVTAGHGLEERARAFEAA 743
                                           ***********************99997778889*************************************** PP

                          Met_synt_B12 145 kddYsailvkaladrLaeAfaellhekvrkelWgyakdeklsneelikekYqgiRpApGYpacpdhtekktlf 217
                                           +ddY+ail+kal drLaeAfae++he+vr+e+W ya+de+lsneeli+e Y+giRpApGYpacpdhtek+tl+
  NCBI__GCF_000016185.1:WP_049766682.1 744 HDDYNAILLKALGDRLAEAFAERMHERVRREFWAYAPDETLSNEELIAEAYRGIRPAPGYPACPDHTEKATLW 816
                                           ************************************************************************* PP

                          Met_synt_B12 218 elldaeekigieLteslamtPaasvsGlyfahpearyFavgkiekdqvedyakrkg 273
                                           +lldae+++gi+Lte++am+P+a+vsG+y+ahpea+yF++gkie+dqv+dya+rkg
  NCBI__GCF_000016185.1:WP_049766682.1 817 RLLDAEKAAGISLTETFAMMPTAAVSGWYIAHPEAKYFGLGKIERDQVADYARRKG 872
                                           ******************************************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (273 nodes)
Target sequences:                          1  (903 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 45.35
//
[ok]

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory