Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_011885194.1 aspartate kinase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000016205.1:WP_011885194.1 Length = 417 Score = 301 bits (770), Expect = 6e-86 Identities = 170/414 (41%), Positives = 260/414 (62%), Gaps = 14/414 (3%) Query: 339 SVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTTDHLIELAKTIDENP 398 +++V K+GG ++ VE+++ VA+++ K ++G + VVV SAM T+ L+ LAK I P Sbjct: 2 ALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQP 61 Query: 399 DPRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKRYGSARIIDINTDII 458 PRELD++ STGE SV L+SIAL++ G +A+S+ G Q+ I TD + ARI I+ + + Sbjct: 62 SPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDERV 121 Query: 459 SRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGADLCELYKDVDGVYTA 518 L + ++ GFQG+ G ITTLGRGGSD +A+A+A +LGA+ C +Y DVDGVYT Sbjct: 122 KADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYTT 181 Query: 519 DPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKV---------LIKNAH 569 DPR+V++AR + +++EEM+E++ G++VLQ R+ EFA KY VK LI Sbjct: 182 DPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALDE 241 Query: 570 KETRGTLIW--EGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGVNID 627 + GTLI E +E ++ + F+ A++ + VPDKPG+A +I+ ++ V++D Sbjct: 242 EMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANVDVD 301 Query: 628 MIIQGMKSGEYNTVAFIVPESQLGK-LDI--DLLKTRSEAKEIIIEKGLAKVSIVGVNLT 684 MIIQ F V K +DI + +K A+ + + ++KVS+VGV + Sbjct: 302 MIIQNQSVEGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAERVQGDPKVSKVSVVGVGMR 361 Query: 685 STPEISATLFETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELDR 738 S +++ +F TL+ EGINI MIS S +ISV+ID KY+E AV+A+H FELD+ Sbjct: 362 SHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQ 415 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 728 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 417 Length adjustment: 36 Effective length of query: 703 Effective length of database: 381 Effective search space: 267843 Effective search space used: 267843 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory