Align Predicted dapE by GapMind curators (no experimental data)
to candidate WP_012101872.1 CKL_RS07285 M20 family metallopeptidase
Query= predicted:L0FXC2 (397 letters) >NCBI__GCF_000016505.1:WP_012101872.1 Length = 390 Score = 294 bits (752), Expect = 3e-84 Identities = 156/379 (41%), Positives = 228/379 (60%), Gaps = 5/379 (1%) Query: 16 QTIAIRRHIHAHPELSFEEHQTCAFVEKHLQEIGITNIQRKANTGLVALIEGKNPSKKVI 75 + I IRR +H HPEL +EE +T +++ L++IGI ++ A TG+ +I GK K I Sbjct: 15 ELIDIRRDLHRHPELGYEEERTSFKIKEFLKKIGIEYMET-AGTGVCGIIRGKG--NKTI 71 Query: 76 ALRADMDALPIVEQNDVPYKSNKEGVMHACGHDVHTSSLLGAASILHAVKDQFEGTVKLI 135 +RAD+DALP+ + + Y S +G MHACGHD HT+ LLG A +L++VKD+ +GTVKL Sbjct: 72 GIRADIDALPLEDHKNCSYSSKVKGKMHACGHDAHTTILLGTAKVLNSVKDELKGTVKLF 131 Query: 136 FQPGEEKIPGGASLMIKDKALENPRPSGIVGQHVMPLIDAGKVGFRKGMYMASADELYLK 195 F+P EE GGA LM+K+ ALENPR ++G HV I+ G +G + G+ A+++ +K Sbjct: 132 FEPAEETT-GGAKLMVKEGALENPRVDRVIGLHVDENIEVGNIGVKLGVVNAASNPFTIK 190 Query: 196 VIGKGGHGAMPETLVDPVLIASHIIVALQQVISRNASPKVPSVLSFGRIEALGATNVIPN 255 + G G HGA P VDP++I+SH+I+ALQQ++SR P +V++ G I A N+IP Sbjct: 191 IKGVGAHGARPHMGVDPIVISSHVILALQQIVSRELPPTDAAVITVGSIHGGTAQNIIPE 250 Query: 256 EVNIQGTFRTLDETWRAEAHQKMVKIAEGIAEGMGGSVDFEVRKGYPFLQNAPELTDRAY 315 EV I GT RT+ R +++ +I G+ M G + ++ + YP L N ++ Sbjct: 251 EVVIAGTMRTMRTEHREYVKERLREITFGVVNSMRGKYEIDIEESYPCLYNDDDVIKDIL 310 Query: 316 KAAQAYLGEENVEDLDI-WMAAEDFSYYTQEMDGCFYRLGIRNEEKGITSGVHTPTFDID 374 KAA +GEE+V+ L+ M E F+Y++ E FY LG RNE K I H FDID Sbjct: 311 KAAYKEIGEEHVKMLESPSMGVESFAYFSMERPSAFYYLGCRNESKNIIYPAHGSLFDID 370 Query: 375 ESALEVGAGLMAWIAINEL 393 E L +G + A + L Sbjct: 371 EDCLPIGVSIQCRAAYDFL 389 Lambda K H 0.317 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 390 Length adjustment: 31 Effective length of query: 366 Effective length of database: 359 Effective search space: 131394 Effective search space used: 131394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory