Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_012102205.1 CKL_RS08890 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000016505.1:WP_012102205.1 Length = 409 Score = 241 bits (615), Expect = 3e-68 Identities = 143/406 (35%), Positives = 234/406 (57%), Gaps = 35/406 (8%) Query: 19 TLAIHGGQSPDPSTGAVMPPIYATSTYAQSSP--------GEHQGFEYSRTHNPTRFAYE 70 T IHG D +TGA P+Y ++ YA +S G+ G+ Y+R NPT ++E Sbjct: 5 TKLIHGNLKTD-ATGATNVPLYLSNAYAHTSAKKLENIFKGKEMGYSYTRISNPTVTSFE 63 Query: 71 RCVAALEGGTRAFAFASGMAATS-TVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGL 129 R +A++E G A + ASGM+A ++M +++ G ++A LYGGT+ L ++ G+ Sbjct: 64 RRIASIENGLIATSAASGMSAIYISIMNIVEPGDEIIASSSLYGGTYTLIRNLK--LLGI 121 Query: 130 DFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFA 189 F++ D A K AI +TK+V+ ET NP L ++DI +++ I +++ ++ ++D+T Sbjct: 122 KVRFLENIDKATLKEAINKNTKLVFAETIGNPKLDVLDIDSVSKICKENNIVLMIDSTIT 181 Query: 190 SPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAE--------------QM 235 +P L +PL GAD+V+HS +KY+NG S+ +GGI V G + + + +M Sbjct: 182 TPYLVKPLEYGADIVIHSTSKYINGTSNSIGGIIVDGGSNKYMDLKYENFRPYTKKYGKM 241 Query: 236 AF-------LQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKV 288 AF ++ IG PF++FL L G++TL LRM+ HC+NAL +A+ L + I V Sbjct: 242 AFTAKLKDTIERDIGPALSPFNAFLNLTGIETLSLRMKEHCKNALTVAEHLMQNSKITDV 301 Query: 289 IYPGLASHPQHVLAKRQMS-GFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLV 347 YPGL + + L K+ S G GGI++ L G + A +F + +L ++G +S++ Sbjct: 302 NYPGLENSKYYDLIKKYYSNGSGGILTFRL-GSKEKAFKFLDNLKLILNLTNIGDTKSII 360 Query: 348 NHPAVMTHASIPVARREQLGISDALVRLSVGIEDLGDLRGDLERAL 393 HP+ A+ ++Q+G+ D L+RLSVGIED+ D+ D+E AL Sbjct: 361 IHPSSTICANNTDEEKQQMGVYDDLLRLSVGIEDVEDILEDIENAL 406 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 409 Length adjustment: 31 Effective length of query: 366 Effective length of database: 378 Effective search space: 138348 Effective search space used: 138348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory